Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1438683..1438908 | Replicon | chromosome |
| Accession | NZ_CP004057 | ||
| Organism | Shigella flexneri Shi06HN006 isolate Human | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | SFYV_RS07865 | Protein ID | WP_000813254.1 |
| Coordinates | 1438753..1438908 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1438683..1438741 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SFYV_RS29260 | 1434681..1434850 | + | 170 | Protein_1416 | hypothetical protein | - |
| SFYV_RS07825 | 1434996..1435742 | + | 747 | WP_000788996.1 | ATP-binding protein | - |
| SFYV_RS07830 | 1435757..1436179 | + | 423 | WP_001118168.1 | DUF977 family protein | - |
| SFYV_RS07835 | 1436237..1436593 | + | 357 | WP_005048249.1 | hypothetical protein | - |
| SFYV_RS07840 | 1436686..1436904 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
| SFYV_RS07845 | 1436906..1437271 | + | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
| SFYV_RS07850 | 1437268..1437933 | + | 666 | WP_000208062.1 | hypothetical protein | - |
| SFYV_RS07855 | 1437933..1438298 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| - | 1438683..1438741 | - | 59 | - | - | Antitoxin |
| SFYV_RS07865 | 1438753..1438908 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| SFYV_RS07880 | 1440245..1440844 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
| SFYV_RS07885 | 1440844..1441134 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| SFYV_RS07890 | 1441131..1441685 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
| SFYV_RS07895 | 1441838..1442011 | + | 174 | WP_000504450.1 | hypothetical protein | - |
| SFYV_RS26030 | 1442073..1443232 | + | 1160 | WP_094106032.1 | IS3-like element IS600 family transposase | - |
| SFYV_RS07910 | 1443260..1443628 | + | 369 | WP_011069357.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 1430766..1485653 | 54887 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T44938 WP_000813254.1 NZ_CP004057:1438753-1438908 [Shigella flexneri Shi06HN006]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T44938 NZ_CP004057:1438753-1438908 [Shigella flexneri Shi06HN006]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT44938 NZ_CP004057:c1438741-1438683 [Shigella flexneri Shi06HN006]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|