Detailed information of TA system TA044526

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 61698..61967
• Replicon: plasmid pJNE132847_1
• Accession: NZ_AP028095
• Organism: Escherichia coli strain JNE132847

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: JE76HU_RS26395
• Protein ID: WP_001372321.1
• Coordinates: 61842..61967 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	61698..61763 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JE76HU_RS26355	57002..57898	+	897	Protein_61	IS3-like element IS600 family transposase	-
JE76HU_RS26360	57941..58141	-	201	Protein_62	transposase	-
JE76HU_RS26365	58241..58567	-	327	WP_032345720.1	hypothetical protein	-
JE76HU_RS26370	58506..60324	+	1819	Protein_64	ParB/RepB/Spo0J family partition protein	-
JE76HU_RS26375	60379..60813	+	435	WP_032345719.1	conjugation system SOS inhibitor PsiB	-
JE76HU_RS26380	60810..61572	+	763	Protein_66	plasmid SOS inhibition protein A	-
JE76HU_RS26385	61541..61729	-	189	WP_001336239.1	hypothetical protein	-
-	61541..61765	+	225	NuclAT_0	-	-
-	61541..61765	+	225	NuclAT_0	-	-
-	61541..61765	+	225	NuclAT_0	-	-
-	61541..61765	+	225	NuclAT_0	-	-
-	61698..61763	+	66	-	-	Antitoxin
JE76HU_RS26390	61751..61900	+	150	Protein_68	plasmid maintenance protein Mok	-
JE76HU_RS26395	61842..61967	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
JE76HU_RS26400	62258..62638	+	381	WP_238890498.1	transposase	-
JE76HU_RS26405	62635..62982	+	348	WP_000612591.1	IS66 family insertion sequence element accessory protein TnpB	-
JE76HU_RS26410	63032..64570	+	1539	WP_000998048.1	IS66-like element ISEc8 family transposase	-
JE76HU_RS26415	64720..65696	-	977	Protein_73	RepB family plasmid replication initiator protein	-
JE76HU_RS26420	66376..66621	-	246	Protein_74	integrase core domain-containing protein	-
JE76HU_RS26425	66623..66910	-	288	WP_001270417.1	type II toxin-antitoxin system RelE/ParE family toxin	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	toxB / hlyD / hlyB / hlyA / hlyC	1..132775	132775
	-	inside	IScluster/Tn	-	-	54258..74600	20342

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T44526 WP_001372321.1 NZ_AP028095:61842-61967 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T44526 NZ_AP028095:61842-61967 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT44526 NZ_AP028095:61698-61763 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin