Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1693863..1694083 Replicon chromosome
Accession NZ_AP027181
Organism Escherichia coli strain 98E11

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag QMG82_RS08855 Protein ID WP_000170954.1
Coordinates 1693863..1693970 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1694020..1694083 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMG82_RS08830 (1689707) 1689707..1690789 + 1083 WP_000804726.1 peptide chain release factor 1 -
QMG82_RS08835 (1690789) 1690789..1691622 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QMG82_RS08840 (1691619) 1691619..1692011 + 393 WP_000200378.1 invasion regulator SirB2 -
QMG82_RS08845 (1692015) 1692015..1692824 + 810 WP_001257045.1 invasion regulator SirB1 -
QMG82_RS08850 (1692860) 1692860..1693714 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QMG82_RS08855 (1693863) 1693863..1693970 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1694020) 1694020..1694083 + 64 NuclAT_32 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_32 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_32 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_32 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_35 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_35 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_35 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_35 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_38 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_38 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_38 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_38 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_41 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_41 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_41 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_41 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_44 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_44 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_44 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_44 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_47 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_47 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_47 - Antitoxin
- (1694020) 1694020..1694083 + 64 NuclAT_47 - Antitoxin
QMG82_RS08860 (1694398) 1694398..1694505 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1694558) 1694558..1694619 + 62 NuclAT_31 - -
- (1694558) 1694558..1694619 + 62 NuclAT_31 - -
- (1694558) 1694558..1694619 + 62 NuclAT_31 - -
- (1694558) 1694558..1694619 + 62 NuclAT_31 - -
- (1694558) 1694558..1694619 + 62 NuclAT_34 - -
- (1694558) 1694558..1694619 + 62 NuclAT_34 - -
- (1694558) 1694558..1694619 + 62 NuclAT_34 - -
- (1694558) 1694558..1694619 + 62 NuclAT_34 - -
- (1694558) 1694558..1694619 + 62 NuclAT_37 - -
- (1694558) 1694558..1694619 + 62 NuclAT_37 - -
- (1694558) 1694558..1694619 + 62 NuclAT_37 - -
- (1694558) 1694558..1694619 + 62 NuclAT_37 - -
- (1694558) 1694558..1694619 + 62 NuclAT_40 - -
- (1694558) 1694558..1694619 + 62 NuclAT_40 - -
- (1694558) 1694558..1694619 + 62 NuclAT_40 - -
- (1694558) 1694558..1694619 + 62 NuclAT_40 - -
- (1694558) 1694558..1694619 + 62 NuclAT_43 - -
- (1694558) 1694558..1694619 + 62 NuclAT_43 - -
- (1694558) 1694558..1694619 + 62 NuclAT_43 - -
- (1694558) 1694558..1694619 + 62 NuclAT_43 - -
- (1694558) 1694558..1694619 + 62 NuclAT_46 - -
- (1694558) 1694558..1694619 + 62 NuclAT_46 - -
- (1694558) 1694558..1694619 + 62 NuclAT_46 - -
- (1694558) 1694558..1694619 + 62 NuclAT_46 - -
- (1694558) 1694558..1694621 + 64 NuclAT_17 - -
- (1694558) 1694558..1694621 + 64 NuclAT_17 - -
- (1694558) 1694558..1694621 + 64 NuclAT_17 - -
- (1694558) 1694558..1694621 + 64 NuclAT_17 - -
- (1694558) 1694558..1694621 + 64 NuclAT_19 - -
- (1694558) 1694558..1694621 + 64 NuclAT_19 - -
- (1694558) 1694558..1694621 + 64 NuclAT_19 - -
- (1694558) 1694558..1694621 + 64 NuclAT_19 - -
- (1694558) 1694558..1694621 + 64 NuclAT_21 - -
- (1694558) 1694558..1694621 + 64 NuclAT_21 - -
- (1694558) 1694558..1694621 + 64 NuclAT_21 - -
- (1694558) 1694558..1694621 + 64 NuclAT_21 - -
- (1694558) 1694558..1694621 + 64 NuclAT_23 - -
- (1694558) 1694558..1694621 + 64 NuclAT_23 - -
- (1694558) 1694558..1694621 + 64 NuclAT_23 - -
- (1694558) 1694558..1694621 + 64 NuclAT_23 - -
- (1694558) 1694558..1694621 + 64 NuclAT_25 - -
- (1694558) 1694558..1694621 + 64 NuclAT_25 - -
- (1694558) 1694558..1694621 + 64 NuclAT_25 - -
- (1694558) 1694558..1694621 + 64 NuclAT_25 - -
- (1694558) 1694558..1694621 + 64 NuclAT_27 - -
- (1694558) 1694558..1694621 + 64 NuclAT_27 - -
- (1694558) 1694558..1694621 + 64 NuclAT_27 - -
- (1694558) 1694558..1694621 + 64 NuclAT_27 - -
QMG82_RS08865 (1694934) 1694934..1695041 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1695089) 1695089..1695154 + 66 NuclAT_30 - -
- (1695089) 1695089..1695154 + 66 NuclAT_30 - -
- (1695089) 1695089..1695154 + 66 NuclAT_30 - -
- (1695089) 1695089..1695154 + 66 NuclAT_30 - -
- (1695089) 1695089..1695154 + 66 NuclAT_33 - -
- (1695089) 1695089..1695154 + 66 NuclAT_33 - -
- (1695089) 1695089..1695154 + 66 NuclAT_33 - -
- (1695089) 1695089..1695154 + 66 NuclAT_33 - -
- (1695089) 1695089..1695154 + 66 NuclAT_36 - -
- (1695089) 1695089..1695154 + 66 NuclAT_36 - -
- (1695089) 1695089..1695154 + 66 NuclAT_36 - -
- (1695089) 1695089..1695154 + 66 NuclAT_36 - -
- (1695089) 1695089..1695154 + 66 NuclAT_39 - -
- (1695089) 1695089..1695154 + 66 NuclAT_39 - -
- (1695089) 1695089..1695154 + 66 NuclAT_39 - -
- (1695089) 1695089..1695154 + 66 NuclAT_39 - -
- (1695089) 1695089..1695154 + 66 NuclAT_42 - -
- (1695089) 1695089..1695154 + 66 NuclAT_42 - -
- (1695089) 1695089..1695154 + 66 NuclAT_42 - -
- (1695089) 1695089..1695154 + 66 NuclAT_42 - -
- (1695089) 1695089..1695154 + 66 NuclAT_45 - -
- (1695089) 1695089..1695154 + 66 NuclAT_45 - -
- (1695089) 1695089..1695154 + 66 NuclAT_45 - -
- (1695089) 1695089..1695154 + 66 NuclAT_45 - -
- (1695089) 1695089..1695156 + 68 NuclAT_16 - -
- (1695089) 1695089..1695156 + 68 NuclAT_16 - -
- (1695089) 1695089..1695156 + 68 NuclAT_16 - -
- (1695089) 1695089..1695156 + 68 NuclAT_16 - -
- (1695089) 1695089..1695156 + 68 NuclAT_18 - -
- (1695089) 1695089..1695156 + 68 NuclAT_18 - -
- (1695089) 1695089..1695156 + 68 NuclAT_18 - -
- (1695089) 1695089..1695156 + 68 NuclAT_18 - -
- (1695089) 1695089..1695156 + 68 NuclAT_20 - -
- (1695089) 1695089..1695156 + 68 NuclAT_20 - -
- (1695089) 1695089..1695156 + 68 NuclAT_20 - -
- (1695089) 1695089..1695156 + 68 NuclAT_20 - -
- (1695089) 1695089..1695156 + 68 NuclAT_22 - -
- (1695089) 1695089..1695156 + 68 NuclAT_22 - -
- (1695089) 1695089..1695156 + 68 NuclAT_22 - -
- (1695089) 1695089..1695156 + 68 NuclAT_22 - -
- (1695089) 1695089..1695156 + 68 NuclAT_24 - -
- (1695089) 1695089..1695156 + 68 NuclAT_24 - -
- (1695089) 1695089..1695156 + 68 NuclAT_24 - -
- (1695089) 1695089..1695156 + 68 NuclAT_24 - -
- (1695089) 1695089..1695156 + 68 NuclAT_26 - -
- (1695089) 1695089..1695156 + 68 NuclAT_26 - -
- (1695089) 1695089..1695156 + 68 NuclAT_26 - -
- (1695089) 1695089..1695156 + 68 NuclAT_26 - -
QMG82_RS08870 (1695446) 1695446..1696546 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QMG82_RS08875 (1696816) 1696816..1697046 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QMG82_RS08880 (1697204) 1697204..1697899 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QMG82_RS08885 (1697943) 1697943..1698296 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T43293 WP_000170954.1 NZ_AP027181:c1693970-1693863 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T43293 NZ_AP027181:c1693970-1693863 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT43293 NZ_AP027181:1694020-1694083 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9


Antitoxin

Download structure file

References