Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1689576..1689796 Replicon chromosome
Accession NZ_AP027170
Organism Escherichia coli strain 20.1

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag QMG87_RS08885 Protein ID WP_000170954.1
Coordinates 1689576..1689683 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1689733..1689796 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMG87_RS08860 (1685420) 1685420..1686502 + 1083 WP_000804726.1 peptide chain release factor 1 -
QMG87_RS08865 (1686502) 1686502..1687335 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QMG87_RS08870 (1687332) 1687332..1687724 + 393 WP_000200378.1 invasion regulator SirB2 -
QMG87_RS08875 (1687728) 1687728..1688537 + 810 WP_001257045.1 invasion regulator SirB1 -
QMG87_RS08880 (1688573) 1688573..1689427 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QMG87_RS08885 (1689576) 1689576..1689683 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1689733) 1689733..1689796 + 64 NuclAT_32 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_32 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_32 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_32 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_35 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_35 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_35 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_35 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_38 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_38 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_38 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_38 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_41 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_41 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_41 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_41 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_44 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_44 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_44 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_44 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_47 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_47 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_47 - Antitoxin
- (1689733) 1689733..1689796 + 64 NuclAT_47 - Antitoxin
QMG87_RS08890 (1690111) 1690111..1690218 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1690271) 1690271..1690332 + 62 NuclAT_31 - -
- (1690271) 1690271..1690332 + 62 NuclAT_31 - -
- (1690271) 1690271..1690332 + 62 NuclAT_31 - -
- (1690271) 1690271..1690332 + 62 NuclAT_31 - -
- (1690271) 1690271..1690332 + 62 NuclAT_34 - -
- (1690271) 1690271..1690332 + 62 NuclAT_34 - -
- (1690271) 1690271..1690332 + 62 NuclAT_34 - -
- (1690271) 1690271..1690332 + 62 NuclAT_34 - -
- (1690271) 1690271..1690332 + 62 NuclAT_37 - -
- (1690271) 1690271..1690332 + 62 NuclAT_37 - -
- (1690271) 1690271..1690332 + 62 NuclAT_37 - -
- (1690271) 1690271..1690332 + 62 NuclAT_37 - -
- (1690271) 1690271..1690332 + 62 NuclAT_40 - -
- (1690271) 1690271..1690332 + 62 NuclAT_40 - -
- (1690271) 1690271..1690332 + 62 NuclAT_40 - -
- (1690271) 1690271..1690332 + 62 NuclAT_40 - -
- (1690271) 1690271..1690332 + 62 NuclAT_43 - -
- (1690271) 1690271..1690332 + 62 NuclAT_43 - -
- (1690271) 1690271..1690332 + 62 NuclAT_43 - -
- (1690271) 1690271..1690332 + 62 NuclAT_43 - -
- (1690271) 1690271..1690332 + 62 NuclAT_46 - -
- (1690271) 1690271..1690332 + 62 NuclAT_46 - -
- (1690271) 1690271..1690332 + 62 NuclAT_46 - -
- (1690271) 1690271..1690332 + 62 NuclAT_46 - -
- (1690271) 1690271..1690334 + 64 NuclAT_17 - -
- (1690271) 1690271..1690334 + 64 NuclAT_17 - -
- (1690271) 1690271..1690334 + 64 NuclAT_17 - -
- (1690271) 1690271..1690334 + 64 NuclAT_17 - -
- (1690271) 1690271..1690334 + 64 NuclAT_19 - -
- (1690271) 1690271..1690334 + 64 NuclAT_19 - -
- (1690271) 1690271..1690334 + 64 NuclAT_19 - -
- (1690271) 1690271..1690334 + 64 NuclAT_19 - -
- (1690271) 1690271..1690334 + 64 NuclAT_21 - -
- (1690271) 1690271..1690334 + 64 NuclAT_21 - -
- (1690271) 1690271..1690334 + 64 NuclAT_21 - -
- (1690271) 1690271..1690334 + 64 NuclAT_21 - -
- (1690271) 1690271..1690334 + 64 NuclAT_23 - -
- (1690271) 1690271..1690334 + 64 NuclAT_23 - -
- (1690271) 1690271..1690334 + 64 NuclAT_23 - -
- (1690271) 1690271..1690334 + 64 NuclAT_23 - -
- (1690271) 1690271..1690334 + 64 NuclAT_25 - -
- (1690271) 1690271..1690334 + 64 NuclAT_25 - -
- (1690271) 1690271..1690334 + 64 NuclAT_25 - -
- (1690271) 1690271..1690334 + 64 NuclAT_25 - -
- (1690271) 1690271..1690334 + 64 NuclAT_27 - -
- (1690271) 1690271..1690334 + 64 NuclAT_27 - -
- (1690271) 1690271..1690334 + 64 NuclAT_27 - -
- (1690271) 1690271..1690334 + 64 NuclAT_27 - -
QMG87_RS08895 (1690647) 1690647..1690754 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1690802) 1690802..1690867 + 66 NuclAT_30 - -
- (1690802) 1690802..1690867 + 66 NuclAT_30 - -
- (1690802) 1690802..1690867 + 66 NuclAT_30 - -
- (1690802) 1690802..1690867 + 66 NuclAT_30 - -
- (1690802) 1690802..1690867 + 66 NuclAT_33 - -
- (1690802) 1690802..1690867 + 66 NuclAT_33 - -
- (1690802) 1690802..1690867 + 66 NuclAT_33 - -
- (1690802) 1690802..1690867 + 66 NuclAT_33 - -
- (1690802) 1690802..1690867 + 66 NuclAT_36 - -
- (1690802) 1690802..1690867 + 66 NuclAT_36 - -
- (1690802) 1690802..1690867 + 66 NuclAT_36 - -
- (1690802) 1690802..1690867 + 66 NuclAT_36 - -
- (1690802) 1690802..1690867 + 66 NuclAT_39 - -
- (1690802) 1690802..1690867 + 66 NuclAT_39 - -
- (1690802) 1690802..1690867 + 66 NuclAT_39 - -
- (1690802) 1690802..1690867 + 66 NuclAT_39 - -
- (1690802) 1690802..1690867 + 66 NuclAT_42 - -
- (1690802) 1690802..1690867 + 66 NuclAT_42 - -
- (1690802) 1690802..1690867 + 66 NuclAT_42 - -
- (1690802) 1690802..1690867 + 66 NuclAT_42 - -
- (1690802) 1690802..1690867 + 66 NuclAT_45 - -
- (1690802) 1690802..1690867 + 66 NuclAT_45 - -
- (1690802) 1690802..1690867 + 66 NuclAT_45 - -
- (1690802) 1690802..1690867 + 66 NuclAT_45 - -
- (1690802) 1690802..1690869 + 68 NuclAT_16 - -
- (1690802) 1690802..1690869 + 68 NuclAT_16 - -
- (1690802) 1690802..1690869 + 68 NuclAT_16 - -
- (1690802) 1690802..1690869 + 68 NuclAT_16 - -
- (1690802) 1690802..1690869 + 68 NuclAT_18 - -
- (1690802) 1690802..1690869 + 68 NuclAT_18 - -
- (1690802) 1690802..1690869 + 68 NuclAT_18 - -
- (1690802) 1690802..1690869 + 68 NuclAT_18 - -
- (1690802) 1690802..1690869 + 68 NuclAT_20 - -
- (1690802) 1690802..1690869 + 68 NuclAT_20 - -
- (1690802) 1690802..1690869 + 68 NuclAT_20 - -
- (1690802) 1690802..1690869 + 68 NuclAT_20 - -
- (1690802) 1690802..1690869 + 68 NuclAT_22 - -
- (1690802) 1690802..1690869 + 68 NuclAT_22 - -
- (1690802) 1690802..1690869 + 68 NuclAT_22 - -
- (1690802) 1690802..1690869 + 68 NuclAT_22 - -
- (1690802) 1690802..1690869 + 68 NuclAT_24 - -
- (1690802) 1690802..1690869 + 68 NuclAT_24 - -
- (1690802) 1690802..1690869 + 68 NuclAT_24 - -
- (1690802) 1690802..1690869 + 68 NuclAT_24 - -
- (1690802) 1690802..1690869 + 68 NuclAT_26 - -
- (1690802) 1690802..1690869 + 68 NuclAT_26 - -
- (1690802) 1690802..1690869 + 68 NuclAT_26 - -
- (1690802) 1690802..1690869 + 68 NuclAT_26 - -
QMG87_RS08900 (1691159) 1691159..1692259 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QMG87_RS08905 (1692529) 1692529..1692759 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QMG87_RS08910 (1692917) 1692917..1693612 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QMG87_RS08915 (1693656) 1693656..1694009 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T43205 WP_000170954.1 NZ_AP027170:c1689683-1689576 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T43205 NZ_AP027170:c1689683-1689576 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT43205 NZ_AP027170:1689733-1689796 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References