Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1748725..1748945 Replicon chromosome
Accession NZ_AP027162
Organism Escherichia coli strain EH031

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag QMG85_RS09120 Protein ID WP_000170954.1
Coordinates 1748725..1748832 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1748882..1748945 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMG85_RS09095 (1744569) 1744569..1745651 + 1083 WP_000804726.1 peptide chain release factor 1 -
QMG85_RS09100 (1745651) 1745651..1746484 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QMG85_RS09105 (1746481) 1746481..1746873 + 393 WP_000200378.1 invasion regulator SirB2 -
QMG85_RS09110 (1746877) 1746877..1747686 + 810 WP_001257045.1 invasion regulator SirB1 -
QMG85_RS09115 (1747722) 1747722..1748576 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QMG85_RS09120 (1748725) 1748725..1748832 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1748882) 1748882..1748945 + 64 NuclAT_32 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_32 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_32 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_32 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_35 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_35 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_35 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_35 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_38 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_38 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_38 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_38 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_41 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_41 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_41 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_41 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_44 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_44 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_44 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_44 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_47 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_47 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_47 - Antitoxin
- (1748882) 1748882..1748945 + 64 NuclAT_47 - Antitoxin
QMG85_RS09125 (1749260) 1749260..1749367 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1749420) 1749420..1749481 + 62 NuclAT_31 - -
- (1749420) 1749420..1749481 + 62 NuclAT_31 - -
- (1749420) 1749420..1749481 + 62 NuclAT_31 - -
- (1749420) 1749420..1749481 + 62 NuclAT_31 - -
- (1749420) 1749420..1749481 + 62 NuclAT_34 - -
- (1749420) 1749420..1749481 + 62 NuclAT_34 - -
- (1749420) 1749420..1749481 + 62 NuclAT_34 - -
- (1749420) 1749420..1749481 + 62 NuclAT_34 - -
- (1749420) 1749420..1749481 + 62 NuclAT_37 - -
- (1749420) 1749420..1749481 + 62 NuclAT_37 - -
- (1749420) 1749420..1749481 + 62 NuclAT_37 - -
- (1749420) 1749420..1749481 + 62 NuclAT_37 - -
- (1749420) 1749420..1749481 + 62 NuclAT_40 - -
- (1749420) 1749420..1749481 + 62 NuclAT_40 - -
- (1749420) 1749420..1749481 + 62 NuclAT_40 - -
- (1749420) 1749420..1749481 + 62 NuclAT_40 - -
- (1749420) 1749420..1749481 + 62 NuclAT_43 - -
- (1749420) 1749420..1749481 + 62 NuclAT_43 - -
- (1749420) 1749420..1749481 + 62 NuclAT_43 - -
- (1749420) 1749420..1749481 + 62 NuclAT_43 - -
- (1749420) 1749420..1749481 + 62 NuclAT_46 - -
- (1749420) 1749420..1749481 + 62 NuclAT_46 - -
- (1749420) 1749420..1749481 + 62 NuclAT_46 - -
- (1749420) 1749420..1749481 + 62 NuclAT_46 - -
- (1749420) 1749420..1749483 + 64 NuclAT_17 - -
- (1749420) 1749420..1749483 + 64 NuclAT_17 - -
- (1749420) 1749420..1749483 + 64 NuclAT_17 - -
- (1749420) 1749420..1749483 + 64 NuclAT_17 - -
- (1749420) 1749420..1749483 + 64 NuclAT_19 - -
- (1749420) 1749420..1749483 + 64 NuclAT_19 - -
- (1749420) 1749420..1749483 + 64 NuclAT_19 - -
- (1749420) 1749420..1749483 + 64 NuclAT_19 - -
- (1749420) 1749420..1749483 + 64 NuclAT_21 - -
- (1749420) 1749420..1749483 + 64 NuclAT_21 - -
- (1749420) 1749420..1749483 + 64 NuclAT_21 - -
- (1749420) 1749420..1749483 + 64 NuclAT_21 - -
- (1749420) 1749420..1749483 + 64 NuclAT_23 - -
- (1749420) 1749420..1749483 + 64 NuclAT_23 - -
- (1749420) 1749420..1749483 + 64 NuclAT_23 - -
- (1749420) 1749420..1749483 + 64 NuclAT_23 - -
- (1749420) 1749420..1749483 + 64 NuclAT_25 - -
- (1749420) 1749420..1749483 + 64 NuclAT_25 - -
- (1749420) 1749420..1749483 + 64 NuclAT_25 - -
- (1749420) 1749420..1749483 + 64 NuclAT_25 - -
- (1749420) 1749420..1749483 + 64 NuclAT_27 - -
- (1749420) 1749420..1749483 + 64 NuclAT_27 - -
- (1749420) 1749420..1749483 + 64 NuclAT_27 - -
- (1749420) 1749420..1749483 + 64 NuclAT_27 - -
QMG85_RS09130 (1749796) 1749796..1749903 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1749951) 1749951..1750016 + 66 NuclAT_30 - -
- (1749951) 1749951..1750016 + 66 NuclAT_30 - -
- (1749951) 1749951..1750016 + 66 NuclAT_30 - -
- (1749951) 1749951..1750016 + 66 NuclAT_30 - -
- (1749951) 1749951..1750016 + 66 NuclAT_33 - -
- (1749951) 1749951..1750016 + 66 NuclAT_33 - -
- (1749951) 1749951..1750016 + 66 NuclAT_33 - -
- (1749951) 1749951..1750016 + 66 NuclAT_33 - -
- (1749951) 1749951..1750016 + 66 NuclAT_36 - -
- (1749951) 1749951..1750016 + 66 NuclAT_36 - -
- (1749951) 1749951..1750016 + 66 NuclAT_36 - -
- (1749951) 1749951..1750016 + 66 NuclAT_36 - -
- (1749951) 1749951..1750016 + 66 NuclAT_39 - -
- (1749951) 1749951..1750016 + 66 NuclAT_39 - -
- (1749951) 1749951..1750016 + 66 NuclAT_39 - -
- (1749951) 1749951..1750016 + 66 NuclAT_39 - -
- (1749951) 1749951..1750016 + 66 NuclAT_42 - -
- (1749951) 1749951..1750016 + 66 NuclAT_42 - -
- (1749951) 1749951..1750016 + 66 NuclAT_42 - -
- (1749951) 1749951..1750016 + 66 NuclAT_42 - -
- (1749951) 1749951..1750016 + 66 NuclAT_45 - -
- (1749951) 1749951..1750016 + 66 NuclAT_45 - -
- (1749951) 1749951..1750016 + 66 NuclAT_45 - -
- (1749951) 1749951..1750016 + 66 NuclAT_45 - -
- (1749951) 1749951..1750018 + 68 NuclAT_16 - -
- (1749951) 1749951..1750018 + 68 NuclAT_16 - -
- (1749951) 1749951..1750018 + 68 NuclAT_16 - -
- (1749951) 1749951..1750018 + 68 NuclAT_16 - -
- (1749951) 1749951..1750018 + 68 NuclAT_18 - -
- (1749951) 1749951..1750018 + 68 NuclAT_18 - -
- (1749951) 1749951..1750018 + 68 NuclAT_18 - -
- (1749951) 1749951..1750018 + 68 NuclAT_18 - -
- (1749951) 1749951..1750018 + 68 NuclAT_20 - -
- (1749951) 1749951..1750018 + 68 NuclAT_20 - -
- (1749951) 1749951..1750018 + 68 NuclAT_20 - -
- (1749951) 1749951..1750018 + 68 NuclAT_20 - -
- (1749951) 1749951..1750018 + 68 NuclAT_22 - -
- (1749951) 1749951..1750018 + 68 NuclAT_22 - -
- (1749951) 1749951..1750018 + 68 NuclAT_22 - -
- (1749951) 1749951..1750018 + 68 NuclAT_22 - -
- (1749951) 1749951..1750018 + 68 NuclAT_24 - -
- (1749951) 1749951..1750018 + 68 NuclAT_24 - -
- (1749951) 1749951..1750018 + 68 NuclAT_24 - -
- (1749951) 1749951..1750018 + 68 NuclAT_24 - -
- (1749951) 1749951..1750018 + 68 NuclAT_26 - -
- (1749951) 1749951..1750018 + 68 NuclAT_26 - -
- (1749951) 1749951..1750018 + 68 NuclAT_26 - -
- (1749951) 1749951..1750018 + 68 NuclAT_26 - -
QMG85_RS09135 (1750308) 1750308..1751408 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QMG85_RS09140 (1751678) 1751678..1751908 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QMG85_RS09145 (1752066) 1752066..1752761 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QMG85_RS09150 (1752805) 1752805..1753158 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T43128 WP_000170954.1 NZ_AP027162:c1748832-1748725 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T43128 NZ_AP027162:c1748832-1748725 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT43128 NZ_AP027162:1748882-1748945 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References