Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 305019..305214 | Replicon | chromosome |
Accession | NZ_AP027136 | ||
Organism | Enterococcus faecalis strain JARB-HU0796 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QUD94_RS01530 | Protein ID | WP_015543884.1 |
Coordinates | 305119..305214 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 305019..305084 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUD94_RS01515 (300637) | 300637..302379 | + | 1743 | WP_010710825.1 | PTS transporter subunit EIIC | - |
QUD94_RS01520 (302370) | 302370..304403 | + | 2034 | WP_078122716.1 | PRD domain-containing protein | - |
QUD94_RS01525 (304414) | 304414..304848 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (305019) | 305019..305084 | + | 66 | NuclAT_9 | - | Antitoxin |
QUD94_RS01530 (305119) | 305119..305214 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QUD94_RS01535 (305460) | 305460..307232 | + | 1773 | WP_010710824.1 | PTS mannitol-specific transporter subunit IIBC | - |
QUD94_RS01540 (307247) | 307247..307684 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QUD94_RS01545 (307699) | 307699..308853 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
QUD94_RS01550 (308921) | 308921..310036 | - | 1116 | WP_010710823.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T43010 WP_015543884.1 NZ_AP027136:c305214-305119 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T43010 NZ_AP027136:c305214-305119 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 66 bp
>AT43010 NZ_AP027136:305019-305084 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|