Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4453254..4453475 Replicon chromosome
Accession NZ_AP026112
Organism Escherichia coli strain CEC03102

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO877_RS22480 Protein ID WP_001295224.1
Coordinates 4453254..4453361 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4453410..4453475 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO877_RS22455 (4448507) 4448507..4449259 - 753 Protein_4402 cellulose biosynthesis protein BcsQ -
OO877_RS22460 (4449271) 4449271..4449459 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO877_RS22465 (4449732) 4449732..4451303 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO877_RS22470 (4451300) 4451300..4451491 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO877_RS22475 (4451488) 4451488..4453167 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO877_RS22480 (4453254) 4453254..4453361 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4453410) 4453410..4453475 + 66 NuclAT_16 - Antitoxin
- (4453410) 4453410..4453475 + 66 NuclAT_16 - Antitoxin
- (4453410) 4453410..4453475 + 66 NuclAT_16 - Antitoxin
- (4453410) 4453410..4453475 + 66 NuclAT_16 - Antitoxin
- (4453410) 4453410..4453475 + 66 NuclAT_21 - Antitoxin
- (4453410) 4453410..4453475 + 66 NuclAT_21 - Antitoxin
- (4453410) 4453410..4453475 + 66 NuclAT_21 - Antitoxin
- (4453410) 4453410..4453475 + 66 NuclAT_21 - Antitoxin
OO877_RS22485 (4453837) 4453837..4455108 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO877_RS22490 (4455138) 4455138..4456142 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO877_RS22495 (4456139) 4456139..4457122 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO877_RS22500 (4457133) 4457133..4458035 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T42340 WP_001295224.1 NZ_AP026112:c4453361-4453254 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T42340 NZ_AP026112:c4453361-4453254 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT42340 NZ_AP026112:4453410-4453475 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References