Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1645914..1646128 Replicon chromosome
Accession NZ_AP026112
Organism Escherichia coli strain CEC03102

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag OO877_RS08040 Protein ID WP_000170963.1
Coordinates 1645914..1646021 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1646069..1646128 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO877_RS08010 (1641223) 1641223..1642305 + 1083 WP_000804726.1 peptide chain release factor 1 -
OO877_RS08015 (1642305) 1642305..1643138 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
OO877_RS08020 (1643135) 1643135..1643527 + 393 WP_000200379.1 invasion regulator SirB2 -
OO877_RS08025 (1643531) 1643531..1644340 + 810 WP_001257044.1 invasion regulator SirB1 -
OO877_RS08030 (1644376) 1644376..1645230 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
OO877_RS08035 (1645378) 1645378..1645485 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1645538) 1645538..1645599 + 62 NuclAT_24 - -
- (1645538) 1645538..1645599 + 62 NuclAT_24 - -
- (1645538) 1645538..1645599 + 62 NuclAT_24 - -
- (1645538) 1645538..1645599 + 62 NuclAT_24 - -
- (1645538) 1645538..1645599 + 62 NuclAT_26 - -
- (1645538) 1645538..1645599 + 62 NuclAT_26 - -
- (1645538) 1645538..1645599 + 62 NuclAT_26 - -
- (1645538) 1645538..1645599 + 62 NuclAT_26 - -
- (1645538) 1645538..1645599 + 62 NuclAT_28 - -
- (1645538) 1645538..1645599 + 62 NuclAT_28 - -
- (1645538) 1645538..1645599 + 62 NuclAT_28 - -
- (1645538) 1645538..1645599 + 62 NuclAT_28 - -
- (1645538) 1645538..1645599 + 62 NuclAT_30 - -
- (1645538) 1645538..1645599 + 62 NuclAT_30 - -
- (1645538) 1645538..1645599 + 62 NuclAT_30 - -
- (1645538) 1645538..1645599 + 62 NuclAT_30 - -
- (1645538) 1645538..1645599 + 62 NuclAT_32 - -
- (1645538) 1645538..1645599 + 62 NuclAT_32 - -
- (1645538) 1645538..1645599 + 62 NuclAT_32 - -
- (1645538) 1645538..1645599 + 62 NuclAT_32 - -
- (1645538) 1645538..1645600 + 63 NuclAT_17 - -
- (1645538) 1645538..1645600 + 63 NuclAT_17 - -
- (1645538) 1645538..1645600 + 63 NuclAT_17 - -
- (1645538) 1645538..1645600 + 63 NuclAT_17 - -
- (1645538) 1645538..1645600 + 63 NuclAT_18 - -
- (1645538) 1645538..1645600 + 63 NuclAT_18 - -
- (1645538) 1645538..1645600 + 63 NuclAT_18 - -
- (1645538) 1645538..1645600 + 63 NuclAT_18 - -
- (1645538) 1645538..1645600 + 63 NuclAT_19 - -
- (1645538) 1645538..1645600 + 63 NuclAT_19 - -
- (1645538) 1645538..1645600 + 63 NuclAT_19 - -
- (1645538) 1645538..1645600 + 63 NuclAT_19 - -
- (1645538) 1645538..1645600 + 63 NuclAT_20 - -
- (1645538) 1645538..1645600 + 63 NuclAT_20 - -
- (1645538) 1645538..1645600 + 63 NuclAT_20 - -
- (1645538) 1645538..1645600 + 63 NuclAT_20 - -
- (1645538) 1645538..1645600 + 63 NuclAT_22 - -
- (1645538) 1645538..1645600 + 63 NuclAT_22 - -
- (1645538) 1645538..1645600 + 63 NuclAT_22 - -
- (1645538) 1645538..1645600 + 63 NuclAT_22 - -
- (1645538) 1645538..1645600 + 63 NuclAT_23 - -
- (1645538) 1645538..1645600 + 63 NuclAT_23 - -
- (1645538) 1645538..1645600 + 63 NuclAT_23 - -
- (1645538) 1645538..1645600 + 63 NuclAT_23 - -
OO877_RS08040 (1645914) 1645914..1646021 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1646069) 1646069..1646128 + 60 NuclAT_25 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_25 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_25 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_25 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_27 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_27 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_27 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_27 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_29 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_29 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_29 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_29 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_31 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_31 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_31 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_31 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_33 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_33 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_33 - Antitoxin
- (1646069) 1646069..1646128 + 60 NuclAT_33 - Antitoxin
OO877_RS08045 (1646420) 1646420..1647520 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
OO877_RS08050 (1647790) 1647790..1648020 + 231 WP_001146444.1 putative cation transport regulator ChaB -
OO877_RS08055 (1648181) 1648181..1648876 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
OO877_RS08060 (1648920) 1648920..1649273 - 354 WP_001169661.1 DsrE/F sulfur relay family protein YchN -
OO877_RS08065 (1649459) 1649459..1650853 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T42319 WP_000170963.1 NZ_AP026112:c1646021-1645914 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T42319 NZ_AP026112:c1646021-1645914 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT42319 NZ_AP026112:1646069-1646128 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References