Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1537408..1537629 Replicon chromosome
Accession NZ_AP025754
Organism Escherichia sp. KS167_9B strain KS-P079

Toxin (Protein)


Gene name ldrD Uniprot ID L4JC91
Locus tag QUE34_RS07635 Protein ID WP_000170956.1
Coordinates 1537408..1537515 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1537568..1537629 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUE34_RS07605 (1532702) 1532702..1533784 + 1083 WP_000804726.1 peptide chain release factor 1 -
QUE34_RS07610 (1533784) 1533784..1534617 + 834 WP_000456456.1 peptide chain release factor N(5)-glutamine methyltransferase -
QUE34_RS07615 (1534614) 1534614..1535006 + 393 WP_000200378.1 invasion regulator SirB2 -
QUE34_RS07620 (1535010) 1535010..1535819 + 810 WP_001257058.1 invasion regulator SirB1 -
QUE34_RS07625 (1535855) 1535855..1536709 + 855 WP_103253927.1 3-deoxy-8-phosphooctulonate synthase -
QUE34_RS07630 (1536873) 1536873..1536980 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1537028) 1537028..1537093 + 66 NuclAT_11 - -
- (1537028) 1537028..1537093 + 66 NuclAT_11 - -
- (1537028) 1537028..1537093 + 66 NuclAT_11 - -
- (1537028) 1537028..1537093 + 66 NuclAT_11 - -
- (1537028) 1537028..1537093 + 66 NuclAT_13 - -
- (1537028) 1537028..1537093 + 66 NuclAT_13 - -
- (1537028) 1537028..1537093 + 66 NuclAT_13 - -
- (1537028) 1537028..1537093 + 66 NuclAT_13 - -
- (1537028) 1537028..1537093 + 66 NuclAT_15 - -
- (1537028) 1537028..1537093 + 66 NuclAT_15 - -
- (1537028) 1537028..1537093 + 66 NuclAT_15 - -
- (1537028) 1537028..1537093 + 66 NuclAT_15 - -
- (1537028) 1537028..1537093 + 66 NuclAT_17 - -
- (1537028) 1537028..1537093 + 66 NuclAT_17 - -
- (1537028) 1537028..1537093 + 66 NuclAT_17 - -
- (1537028) 1537028..1537093 + 66 NuclAT_17 - -
- (1537028) 1537028..1537093 + 66 NuclAT_19 - -
- (1537028) 1537028..1537093 + 66 NuclAT_19 - -
- (1537028) 1537028..1537093 + 66 NuclAT_19 - -
- (1537028) 1537028..1537093 + 66 NuclAT_19 - -
- (1537028) 1537028..1537093 + 66 NuclAT_21 - -
- (1537028) 1537028..1537093 + 66 NuclAT_21 - -
- (1537028) 1537028..1537093 + 66 NuclAT_21 - -
- (1537028) 1537028..1537093 + 66 NuclAT_21 - -
- (1537029) 1537029..1537094 + 66 NuclAT_25 - -
- (1537029) 1537029..1537094 + 66 NuclAT_25 - -
- (1537029) 1537029..1537094 + 66 NuclAT_25 - -
- (1537029) 1537029..1537094 + 66 NuclAT_25 - -
- (1537029) 1537029..1537094 + 66 NuclAT_29 - -
- (1537029) 1537029..1537094 + 66 NuclAT_29 - -
- (1537029) 1537029..1537094 + 66 NuclAT_29 - -
- (1537029) 1537029..1537094 + 66 NuclAT_29 - -
- (1537029) 1537029..1537094 + 66 NuclAT_33 - -
- (1537029) 1537029..1537094 + 66 NuclAT_33 - -
- (1537029) 1537029..1537094 + 66 NuclAT_33 - -
- (1537029) 1537029..1537094 + 66 NuclAT_33 - -
- (1537029) 1537029..1537094 + 66 NuclAT_37 - -
- (1537029) 1537029..1537094 + 66 NuclAT_37 - -
- (1537029) 1537029..1537094 + 66 NuclAT_37 - -
- (1537029) 1537029..1537094 + 66 NuclAT_37 - -
- (1537029) 1537029..1537094 + 66 NuclAT_41 - -
- (1537029) 1537029..1537094 + 66 NuclAT_41 - -
- (1537029) 1537029..1537094 + 66 NuclAT_41 - -
- (1537029) 1537029..1537094 + 66 NuclAT_41 - -
- (1537028) 1537028..1537095 + 68 NuclAT_23 - -
- (1537028) 1537028..1537095 + 68 NuclAT_23 - -
- (1537028) 1537028..1537095 + 68 NuclAT_23 - -
- (1537028) 1537028..1537095 + 68 NuclAT_23 - -
- (1537028) 1537028..1537095 + 68 NuclAT_27 - -
- (1537028) 1537028..1537095 + 68 NuclAT_27 - -
- (1537028) 1537028..1537095 + 68 NuclAT_27 - -
- (1537028) 1537028..1537095 + 68 NuclAT_27 - -
- (1537028) 1537028..1537095 + 68 NuclAT_31 - -
- (1537028) 1537028..1537095 + 68 NuclAT_31 - -
- (1537028) 1537028..1537095 + 68 NuclAT_31 - -
- (1537028) 1537028..1537095 + 68 NuclAT_31 - -
- (1537028) 1537028..1537095 + 68 NuclAT_35 - -
- (1537028) 1537028..1537095 + 68 NuclAT_35 - -
- (1537028) 1537028..1537095 + 68 NuclAT_35 - -
- (1537028) 1537028..1537095 + 68 NuclAT_35 - -
- (1537028) 1537028..1537095 + 68 NuclAT_39 - -
- (1537028) 1537028..1537095 + 68 NuclAT_39 - -
- (1537028) 1537028..1537095 + 68 NuclAT_39 - -
- (1537028) 1537028..1537095 + 68 NuclAT_39 - -
- (1537028) 1537028..1537095 + 68 NuclAT_43 - -
- (1537028) 1537028..1537095 + 68 NuclAT_43 - -
- (1537028) 1537028..1537095 + 68 NuclAT_43 - -
- (1537028) 1537028..1537095 + 68 NuclAT_43 - -
QUE34_RS07635 (1537408) 1537408..1537515 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1537568) 1537568..1537629 + 62 NuclAT_12 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_12 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_12 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_12 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_14 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_14 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_14 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_14 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_16 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_16 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_16 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_16 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_18 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_18 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_18 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_18 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_20 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_20 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_20 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_20 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_22 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_22 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_22 - Antitoxin
- (1537568) 1537568..1537629 + 62 NuclAT_22 - Antitoxin
- (1537568) 1537568..1537630 + 63 NuclAT_26 - -
- (1537568) 1537568..1537630 + 63 NuclAT_26 - -
- (1537568) 1537568..1537630 + 63 NuclAT_26 - -
- (1537568) 1537568..1537630 + 63 NuclAT_26 - -
- (1537568) 1537568..1537630 + 63 NuclAT_30 - -
- (1537568) 1537568..1537630 + 63 NuclAT_30 - -
- (1537568) 1537568..1537630 + 63 NuclAT_30 - -
- (1537568) 1537568..1537630 + 63 NuclAT_30 - -
- (1537568) 1537568..1537630 + 63 NuclAT_34 - -
- (1537568) 1537568..1537630 + 63 NuclAT_34 - -
- (1537568) 1537568..1537630 + 63 NuclAT_34 - -
- (1537568) 1537568..1537630 + 63 NuclAT_34 - -
- (1537568) 1537568..1537630 + 63 NuclAT_38 - -
- (1537568) 1537568..1537630 + 63 NuclAT_38 - -
- (1537568) 1537568..1537630 + 63 NuclAT_38 - -
- (1537568) 1537568..1537630 + 63 NuclAT_38 - -
- (1537568) 1537568..1537630 + 63 NuclAT_42 - -
- (1537568) 1537568..1537630 + 63 NuclAT_42 - -
- (1537568) 1537568..1537630 + 63 NuclAT_42 - -
- (1537568) 1537568..1537630 + 63 NuclAT_42 - -
- (1537568) 1537568..1537631 + 64 NuclAT_24 - -
- (1537568) 1537568..1537631 + 64 NuclAT_24 - -
- (1537568) 1537568..1537631 + 64 NuclAT_24 - -
- (1537568) 1537568..1537631 + 64 NuclAT_24 - -
- (1537568) 1537568..1537631 + 64 NuclAT_28 - -
- (1537568) 1537568..1537631 + 64 NuclAT_28 - -
- (1537568) 1537568..1537631 + 64 NuclAT_28 - -
- (1537568) 1537568..1537631 + 64 NuclAT_28 - -
- (1537568) 1537568..1537631 + 64 NuclAT_32 - -
- (1537568) 1537568..1537631 + 64 NuclAT_32 - -
- (1537568) 1537568..1537631 + 64 NuclAT_32 - -
- (1537568) 1537568..1537631 + 64 NuclAT_32 - -
- (1537568) 1537568..1537631 + 64 NuclAT_36 - -
- (1537568) 1537568..1537631 + 64 NuclAT_36 - -
- (1537568) 1537568..1537631 + 64 NuclAT_36 - -
- (1537568) 1537568..1537631 + 64 NuclAT_36 - -
- (1537568) 1537568..1537631 + 64 NuclAT_40 - -
- (1537568) 1537568..1537631 + 64 NuclAT_40 - -
- (1537568) 1537568..1537631 + 64 NuclAT_40 - -
- (1537568) 1537568..1537631 + 64 NuclAT_40 - -
- (1537568) 1537568..1537631 + 64 NuclAT_44 - -
- (1537568) 1537568..1537631 + 64 NuclAT_44 - -
- (1537568) 1537568..1537631 + 64 NuclAT_44 - -
- (1537568) 1537568..1537631 + 64 NuclAT_44 - -
QUE34_RS07640 (1537921) 1537921..1539021 - 1101 WP_103253928.1 sodium-potassium/proton antiporter ChaA -
QUE34_RS07645 (1539290) 1539290..1539520 + 231 WP_001146444.1 putative cation transport regulator ChaB -
QUE34_RS07650 (1539677) 1539677..1540372 + 696 Protein_1495 glutathione-specific gamma-glutamylcyclotransferase -
QUE34_RS07655 (1540417) 1540417..1540770 - 354 WP_103253929.1 DsrE/F sulfur relay family protein YchN -
QUE34_RS07660 (1540956) 1540956..1542350 + 1395 WP_103253934.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4041.88 Da        Isoelectric Point: 11.4779

>T40831 WP_000170956.1 NZ_AP025754:c1537515-1537408 [Escherichia sp. KS167_9B]
MTLAQFAMIFWHDLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T40831 NZ_AP025754:c1537515-1537408 [Escherichia sp. KS167_9B]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT40831 NZ_AP025754:1537568-1537629 [Escherichia sp. KS167_9B]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G035

Antitoxin

Download structure file

References