Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1535389..1535609 Replicon chromosome
Accession NZ_AP025747
Organism Escherichia sp. HH091_1A strain HH-P024

Toxin (Protein)


Gene name ldrD Uniprot ID -
Locus tag QUF14_RS07560 Protein ID WP_100733948.1
Coordinates 1535389..1535496 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1535543..1535609 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUF14_RS07535 1531234..1532316 + 1083 WP_000804726.1 peptide chain release factor 1 -
QUF14_RS07540 1532316..1533149 + 834 WP_000456456.1 peptide chain release factor N(5)-glutamine methyltransferase -
QUF14_RS07545 1533146..1533538 + 393 WP_000200378.1 invasion regulator SirB2 -
QUF14_RS07550 1533542..1534351 + 810 WP_001257058.1 invasion regulator SirB1 -
QUF14_RS07555 1534387..1535241 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QUF14_RS07560 1535389..1535496 - 108 WP_100733948.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1535543..1535609 + 67 - - Antitoxin
QUF14_RS07565 1535924..1536031 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1536084..1536145 + 62 NuclAT_12 - -
- 1536084..1536145 + 62 NuclAT_12 - -
- 1536084..1536145 + 62 NuclAT_12 - -
- 1536084..1536145 + 62 NuclAT_12 - -
- 1536084..1536145 + 62 NuclAT_14 - -
- 1536084..1536145 + 62 NuclAT_14 - -
- 1536084..1536145 + 62 NuclAT_14 - -
- 1536084..1536145 + 62 NuclAT_14 - -
- 1536084..1536145 + 62 NuclAT_16 - -
- 1536084..1536145 + 62 NuclAT_16 - -
- 1536084..1536145 + 62 NuclAT_16 - -
- 1536084..1536145 + 62 NuclAT_16 - -
- 1536084..1536145 + 62 NuclAT_18 - -
- 1536084..1536145 + 62 NuclAT_18 - -
- 1536084..1536145 + 62 NuclAT_18 - -
- 1536084..1536145 + 62 NuclAT_18 - -
- 1536084..1536145 + 62 NuclAT_20 - -
- 1536084..1536145 + 62 NuclAT_20 - -
- 1536084..1536145 + 62 NuclAT_20 - -
- 1536084..1536145 + 62 NuclAT_20 - -
- 1536084..1536145 + 62 NuclAT_22 - -
- 1536084..1536145 + 62 NuclAT_22 - -
- 1536084..1536145 + 62 NuclAT_22 - -
- 1536084..1536145 + 62 NuclAT_22 - -
- 1536084..1536146 + 63 NuclAT_28 - -
- 1536084..1536146 + 63 NuclAT_28 - -
- 1536084..1536146 + 63 NuclAT_28 - -
- 1536084..1536146 + 63 NuclAT_28 - -
- 1536084..1536146 + 63 NuclAT_32 - -
- 1536084..1536146 + 63 NuclAT_32 - -
- 1536084..1536146 + 63 NuclAT_32 - -
- 1536084..1536146 + 63 NuclAT_32 - -
- 1536084..1536146 + 63 NuclAT_36 - -
- 1536084..1536146 + 63 NuclAT_36 - -
- 1536084..1536146 + 63 NuclAT_36 - -
- 1536084..1536146 + 63 NuclAT_36 - -
- 1536084..1536146 + 63 NuclAT_40 - -
- 1536084..1536146 + 63 NuclAT_40 - -
- 1536084..1536146 + 63 NuclAT_40 - -
- 1536084..1536146 + 63 NuclAT_40 - -
- 1536084..1536147 + 64 NuclAT_26 - -
- 1536084..1536147 + 64 NuclAT_26 - -
- 1536084..1536147 + 64 NuclAT_26 - -
- 1536084..1536147 + 64 NuclAT_26 - -
- 1536084..1536147 + 64 NuclAT_30 - -
- 1536084..1536147 + 64 NuclAT_30 - -
- 1536084..1536147 + 64 NuclAT_30 - -
- 1536084..1536147 + 64 NuclAT_30 - -
- 1536084..1536147 + 64 NuclAT_34 - -
- 1536084..1536147 + 64 NuclAT_34 - -
- 1536084..1536147 + 64 NuclAT_34 - -
- 1536084..1536147 + 64 NuclAT_34 - -
- 1536084..1536147 + 64 NuclAT_38 - -
- 1536084..1536147 + 64 NuclAT_38 - -
- 1536084..1536147 + 64 NuclAT_38 - -
- 1536084..1536147 + 64 NuclAT_38 - -
- 1536084..1536147 + 64 NuclAT_42 - -
- 1536084..1536147 + 64 NuclAT_42 - -
- 1536084..1536147 + 64 NuclAT_42 - -
- 1536084..1536147 + 64 NuclAT_42 - -
QUF14_RS07570 1536437..1537537 - 1101 WP_001306585.1 sodium-potassium/proton antiporter ChaA -
QUF14_RS07575 1537807..1538037 + 231 WP_001146444.1 putative cation transport regulator ChaB -
QUF14_RS07580 1538194..1538889 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QUF14_RS07585 1538933..1539286 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4028.84 Da        Isoelectric Point: 11.6501

>T40742 WP_100733948.1 NZ_AP025747:c1535496-1535389 [Escherichia sp. HH091_1A]
MKLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T40742 NZ_AP025747:c1535496-1535389 [Escherichia sp. HH091_1A]
ATGAAGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT40742 NZ_AP025747:1535543-1535609 [Escherichia sp. HH091_1A]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References