Detailed information of TA system TA040574

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 25493..25762
• Replicon: plasmid pRb3
• Accession: NZ_AP025676
• Organism: Escherichia coli strain Rb-3

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: MWM15_RS24255
• Protein ID: WP_001372321.1
• Coordinates: 25637..25762 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	25493..25558 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
MWM15_RS24215	20529..20753	+	225	WP_102790241.1	hypothetical protein	-
MWM15_RS24220	21262..21801	+	540	WP_001530505.1	single-stranded DNA-binding protein	-
MWM15_RS24225	21863..22096	+	234	WP_000006030.1	DUF905 family protein	-
MWM15_RS24230	22161..24119	+	1959	WP_244338002.1	ParB/RepB/Spo0J family partition protein	-
MWM15_RS24235	24174..24608	+	435	WP_000845910.1	conjugation system SOS inhibitor PsiB	-
MWM15_RS24240	24605..25367	+	763	Protein_34	plasmid SOS inhibition protein A	-
MWM15_RS24245	25336..25524	-	189	WP_001336239.1	hypothetical protein	-
-	25336..25560	+	225	NuclAT_0	-	-
-	25336..25560	+	225	NuclAT_0	-	-
-	25336..25560	+	225	NuclAT_0	-	-
-	25336..25560	+	225	NuclAT_0	-	-
-	25493..25558	+	66	-	-	Antitoxin
MWM15_RS24250	25546..25695	+	150	Protein_36	plasmid maintenance protein Mok	-
MWM15_RS24255	25637..25762	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
MWM15_RS24260	25982..26212	+	231	WP_071593758.1	hypothetical protein	-
MWM15_RS24265	26210..26407	-	198	Protein_39	hypothetical protein	-
MWM15_RS24270	26409..26696	+	288	WP_000107535.1	hypothetical protein	-
MWM15_RS24275	26816..27637	+	822	WP_001234469.1	DUF932 domain-containing protein	-
MWM15_RS24280	27932..28534	-	603	WP_077539848.1	transglycosylase SLT domain-containing protein	-
MWM15_RS24285	28855..29238	+	384	WP_001151538.1	conjugal transfer relaxosome DNA-binding protein TraM	-
MWM15_RS24290	29425..30114	+	690	WP_016239105.1	conjugal transfer transcriptional regulator TraJ	-
MWM15_RS24295	30207..30608	+	402	WP_001369361.1	conjugal transfer relaxosome DNA-bindin protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..66920	66920

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T40574 WP_001372321.1 NZ_AP025676:25637-25762 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T40574 NZ_AP025676:25637-25762 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT40574 NZ_AP025676:25493-25558 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin