Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53838..54077 | Replicon | plasmid pF070-NDM5 |
| Accession | NZ_AP023238 | ||
| Organism | Escherichia coli strain F070 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | FJI53_RS23675 | Protein ID | WP_023144756.1 |
| Coordinates | 53838..53972 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 54017..54077 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FJI53_RS23650 | 49539..50396 | - | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
| FJI53_RS23655 | 50389..50463 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| FJI53_RS23910 | 50460..50594 | - | 135 | Protein_63 | protein CopA/IncA | - |
| FJI53_RS23660 | 50825..52366 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| FJI53_RS23665 | 52381..53127 | + | 747 | WP_053906593.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| FJI53_RS23670 | 53287..53541 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| FJI53_RS23675 | 53838..53972 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 54017..54077 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 54017..54077 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 54017..54077 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 54017..54077 | + | 61 | NuclAT_0 | - | Antitoxin |
| FJI53_RS23680 | 54044..54330 | - | 287 | Protein_68 | DUF2726 domain-containing protein | - |
| FJI53_RS23685 | 54843..55055 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| FJI53_RS23690 | 55186..55746 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| FJI53_RS23695 | 55801..56547 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
| FJI53_RS23700 | 56567..58960 | - | 2394 | Protein_72 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / aadA5 / blaTEM-1B / aac(3)-IId / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 / aac(6')-Ib-cr | - | 1..93649 | 93649 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T37066 WP_023144756.1 NZ_AP023238:c53972-53838 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T37066 NZ_AP023238:c53972-53838 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT37066 NZ_AP023238:54017-54077 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|