Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 23493..23762 | Replicon | plasmid pWP8-S17-ESBL-12_3 |
| Accession | NZ_AP022225 | ||
| Organism | Escherichia coli strain WP8-S17-ESBL-12 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | H7R20_RS25200 | Protein ID | WP_001312861.1 |
| Coordinates | 23604..23762 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 23493..23558 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R20_RS25170 | 19262..19789 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| H7R20_RS25175 | 19847..20080 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| H7R20_RS25180 | 20141..22105 | + | 1965 | WP_000117316.1 | ParB/RepB/Spo0J family partition protein | - |
| H7R20_RS25185 | 22174..22608 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| H7R20_RS25190 | 22605..23324 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 23336..23560 | + | 225 | NuclAT_0 | - | - |
| - | 23336..23560 | + | 225 | NuclAT_0 | - | - |
| - | 23336..23560 | + | 225 | NuclAT_0 | - | - |
| - | 23336..23560 | + | 225 | NuclAT_0 | - | - |
| H7R20_RS25195 | 23345..23524 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 23493..23558 | + | 66 | - | - | Antitoxin |
| H7R20_RS25200 | 23604..23762 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H7R20_RS25205 | 24678..24974 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| H7R20_RS25210 | 25085..25906 | + | 822 | WP_122989966.1 | DUF945 domain-containing protein | - |
| H7R20_RS25215 | 26203..26805 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| H7R20_RS25220 | 27125..27508 | + | 384 | WP_001151538.1 | relaxosome protein TraM | - |
| H7R20_RS25225 | 27695..28382 | + | 688 | Protein_37 | conjugal transfer transcriptional regulator TraJ | - |
| H7R20_RS25230 | 28480..28689 | + | 210 | WP_182924585.1 | TraY domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..70764 | 70764 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T35051 WP_001312861.1 NZ_AP022225:23604-23762 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T35051 NZ_AP022225:23604-23762 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT35051 NZ_AP022225:23493-23558 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|