Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53734..54155 | Replicon | plasmid pWP4-S18-ESBL-08_1 |
| Accession | NZ_AP022096 | ||
| Organism | Escherichia coli strain WP4-S18-ESBL-08 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | B1VC78 |
| Locus tag | H7R08_RS23930 | Protein ID | WP_001302184.1 |
| Coordinates | 53997..54155 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 53734..53932 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R08_RS23900 | 48837..49346 | - | 510 | WP_071600123.1 | hypothetical protein | - |
| H7R08_RS23905 | 49664..50203 | + | 540 | WP_000290801.1 | single-stranded DNA-binding protein | - |
| H7R08_RS23910 | 50260..50493 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| H7R08_RS23915 | 50559..52517 | + | 1959 | WP_029487628.1 | ParB/RepB/Spo0J family partition protein | - |
| H7R08_RS23920 | 52572..53006 | + | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
| H7R08_RS23925 | 53003..53722 | + | 720 | WP_000116348.1 | plasmid SOS inhibition protein A | - |
| - | 53734..53932 | + | 199 | NuclAT_0 | - | Antitoxin |
| - | 53734..53932 | + | 199 | NuclAT_0 | - | Antitoxin |
| - | 53734..53932 | + | 199 | NuclAT_0 | - | Antitoxin |
| - | 53734..53932 | + | 199 | NuclAT_0 | - | Antitoxin |
| H7R08_RS23930 | 53997..54155 | + | 159 | WP_001302184.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H7R08_RS23935 | 54393..54752 | - | 360 | Protein_56 | hypothetical protein | - |
| H7R08_RS23940 | 54822..55028 | + | 207 | WP_000547965.1 | hypothetical protein | - |
| H7R08_RS23945 | 55053..55340 | + | 288 | WP_000107546.1 | hypothetical protein | - |
| H7R08_RS23950 | 55459..56280 | + | 822 | WP_001234475.1 | DUF945 domain-containing protein | - |
| H7R08_RS23955 | 56575..57165 | - | 591 | WP_166494936.1 | transglycosylase SLT domain-containing protein | - |
| H7R08_RS23960 | 57517..57900 | + | 384 | WP_001063020.1 | relaxosome protein TraM | - |
| H7R08_RS23965 | 58092..58739 | + | 648 | WP_000332520.1 | conjugal transfer transcriptional regulator TraJ | - |
| H7R08_RS23970 | 58875..59090 | + | 216 | WP_001352842.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / blaTEM-1B | iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB | 1..158292 | 158292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6108.35 Da Isoelectric Point: 9.1977
>T34481 WP_001302184.1 NZ_AP022096:53997-54155 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 159 bp
>T34481 NZ_AP022096:53997-54155 [Escherichia coli]
ATGAAACTACCACGCAGCTCTCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGCAGCTCTCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 199 bp
>AT34481 NZ_AP022096:53734-53932 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGACGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGACGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|