Detailed information of TA system TA034343

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 91609..91848
• Replicon: plasmid pWP4-W18-ESBL-08_1
• Accession: NZ_AP022065
• Organism: Escherichia coli strain WP4-W18-ESBL-08

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: H7R03_RS24400
• Protein ID: WP_023144756.1
• Coordinates: 91714..91848 (+)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	91609..91669 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
H7R03_RS24370	87400..87960	+	561	WP_000139341.1	fertility inhibition protein FinO	-
H7R03_RS24375	88091..88303	+	213	WP_013023861.1	hypothetical protein	-
H7R03_RS24380	88862..89287	+	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
H7R03_RS24385	89284..89634	+	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
H7R03_RS24390	89665..91278	+	1614	WP_000080195.1	IS66-like element ISEc23 family transposase	-
H7R03_RS24395	91356..91642	+	287	Protein_99	DUF2726 domain-containing protein	-
-	91609..91669	-	61	NuclAT_2	-	Antitoxin
-	91609..91669	-	61	NuclAT_2	-	Antitoxin
-	91609..91669	-	61	NuclAT_2	-	Antitoxin
-	91609..91669	-	61	NuclAT_2	-	Antitoxin
H7R03_RS24400	91714..91848	+	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
H7R03_RS24405	92145..92399	+	255	WP_000083850.1	replication regulatory protein RepA	-
H7R03_RS25280	92505..92639	+	135	Protein_102	protein CopA/IncA	-
H7R03_RS24410	92636..92710	+	75	WP_031943482.1	RepA leader peptide Tap	-
H7R03_RS24415	92703..93560	+	858	WP_001617855.1	incFII family plasmid replication initiator RepA	-
H7R03_RS24420	94500..95153	+	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
H7R03_RS24425	95246..95503	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
H7R03_RS24430	95436..95837	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
H7R03_RS24435	96086..96501	+	416	Protein_108	IS1 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17	senB	1..134864	134864

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T34343 WP_023144756.1 NZ_AP022065:91714-91848 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

>T34343 NZ_AP022065:91714-91848 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA

Antitoxin

Nucleotide

• Length: 61 bp

>AT34343 NZ_AP022065:c91669-91609 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin