Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 31960..32230 | Replicon | plasmid pE2855-5 |
| Accession | NZ_AP018801 | ||
| Organism | Escherichia coli strain E2855 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | MCREHEC_RS30990 | Protein ID | WP_001312861.1 |
| Coordinates | 32072..32230 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 31960..32023 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MCREHEC_RS30940 | 27164..27435 | - | 272 | Protein_40 | hypothetical protein | - |
| MCREHEC_RS30955 | 27733..28254 | + | 522 | WP_021553184.1 | single-stranded DNA-binding protein | - |
| MCREHEC_RS30965 | 28312..28545 | + | 234 | WP_021553185.1 | DUF905 domain-containing protein | - |
| MCREHEC_RS30970 | 28609..30573 | + | 1965 | WP_078183929.1 | ParB/RepB/Spo0J family partition protein | - |
| MCREHEC_RS30975 | 30642..31076 | + | 435 | WP_000845908.1 | conjugation system SOS inhibitor PsiB | - |
| MCREHEC_RS30980 | 31073..31792 | + | 720 | WP_078183928.1 | plasmid SOS inhibition protein A | - |
| MCREHEC_RS30985 | 31804..31992 | - | 189 | WP_032145107.1 | hypothetical protein | - |
| - | 31804..32028 | + | 225 | NuclAT_0 | - | - |
| - | 31804..32028 | + | 225 | NuclAT_0 | - | - |
| - | 31804..32028 | + | 225 | NuclAT_0 | - | - |
| - | 31804..32028 | + | 225 | NuclAT_0 | - | - |
| - | 31960..32023 | - | 64 | - | - | Antitoxin |
| MCREHEC_RS30990 | 32072..32230 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| MCREHEC_RS31005 | 32898..33101 | + | 204 | Protein_48 | single-stranded DNA-binding protein | - |
| MCREHEC_RS31010 | 33124..33447 | + | 324 | WP_000533253.1 | hypothetical protein | - |
| MCREHEC_RS31015 | 33506..33748 | + | 243 | WP_000540591.1 | hypothetical protein | - |
| MCREHEC_RS31040 | 34671..34967 | + | 297 | WP_021553188.1 | hypothetical protein | - |
| MCREHEC_RS31045 | 35078..35899 | + | 822 | WP_021553189.1 | DUF945 domain-containing protein | - |
| MCREHEC_RS31050 | 36195..36704 | - | 510 | WP_021553190.1 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..71289 | 71289 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T32315 WP_001312861.1 NZ_AP018801:32072-32230 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T32315 NZ_AP018801:32072-32230 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT32315 NZ_AP018801:c32023-31960 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|