Detailed information of TA system TA297139

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 34089..34358
• Replicon: plasmid P2
• Accession: NZ_OX637963
• Organism: Escherichia coli O25b:H4-ST131 isolate 86

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QQG89_RS24950
• Protein ID: WP_001372321.1
• Coordinates: 34233..34358 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	34089..34154 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQG89_RS24915	29799..30326	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
QQG89_RS24920	30384..30617	+	234	WP_000006003.1	DUF905 family protein	-
QQG89_RS24925	30678..32701	+	2024	Protein_39	ParB/RepB/Spo0J family partition protein	-
QQG89_RS24930	32770..33204	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QQG89_RS24935	33201..33963	+	763	Protein_41	plasmid SOS inhibition protein A	-
-	33932..34156	+	225	NuclAT_0	-	-
-	33932..34156	+	225	NuclAT_0	-	-
-	33932..34156	+	225	NuclAT_0	-	-
-	33932..34156	+	225	NuclAT_0	-	-
QQG89_RS24940	33941..34120	-	180	WP_001309233.1	hypothetical protein	-
-	34089..34154	-	66	-	-	Antitoxin
QQG89_RS24945	34142..34291	+	150	Protein_43	plasmid maintenance protein Mok	-
QQG89_RS24950	34233..34358	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QQG89_RS24955	34716..35141	+	426	WP_000422741.1	transposase	-
QQG89_RS24960	35138..35488	+	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
QQG89_RS24965	35519..37132	+	1614	WP_000080200.1	IS66-like element ISEc23 family transposase	-
QQG89_RS24970	37217..37513	-	297	Protein_48	hypothetical protein	-
QQG89_RS24975	37813..38109	+	297	WP_001272251.1	hypothetical protein	-
QQG89_RS24980	38220..39041	+	822	WP_001234445.1	DUF932 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T297139 WP_001372321.1 NZ_OX637963:34233-34358 [Escherichia coli O25b:H4-ST131]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT297139 NZ_OX637963:c34154-34089 [Escherichia coli O25b:H4-ST131]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin