Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1157912..1158539 Replicon chromosome
Accession NZ_OX461105
Organism Serratia proteamaculans strain EBP3064 isolate EBP3064

Toxin (Protein)


Gene name Hha Uniprot ID A0A2X2GU35
Locus tag QOT07_RS05355 Protein ID WP_012005558.1
Coordinates 1157912..1158115 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag QOT07_RS05360 Protein ID WP_004940312.1
Coordinates 1158171..1158539 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOT07_RS05340 1153471..1154814 - 1344 WP_219015551.1 NCS2 family permease -
QOT07_RS05345 1154978..1156765 - 1788 WP_099065376.1 adenine deaminase C-terminal domain-containing protein -
QOT07_RS05350 1156903..1157832 + 930 WP_099065375.1 LysR family transcriptional regulator -
QOT07_RS05355 1157912..1158115 - 204 WP_012005558.1 HHA domain-containing protein Toxin
QOT07_RS05360 1158171..1158539 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
QOT07_RS05365 1158702..1159055 - 354 WP_232519151.1 hypothetical protein -
QOT07_RS05370 1159504..1160217 + 714 WP_283602679.1 ABC transporter ATP-binding protein -
QOT07_RS05375 1160214..1161071 + 858 WP_112347678.1 metal ABC transporter permease -
QOT07_RS05380 1161097..1161975 + 879 WP_283602680.1 metal ABC transporter substrate-binding protein -
QOT07_RS05385 1162093..1162233 - 141 WP_085115485.1 type B 50S ribosomal protein L36 -
QOT07_RS05390 1162246..1162503 - 258 WP_099065369.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8101.45 Da        Isoelectric Point: 6.9770

>T297056 WP_012005558.1 NZ_OX461105:c1158115-1157912 [Serratia proteamaculans]
MTKIDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTAVWKFVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT297056 WP_004940312.1 NZ_OX461105:c1158539-1158171 [Serratia proteamaculans]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2X2GU35

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References