Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 121607..122211 | Replicon | chromosome |
Accession | NZ_OX365700 | ||
Organism | Nitrospira sp. DNF |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QWI75_RS00585 | Protein ID | WP_289266738.1 |
Coordinates | 121915..122211 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QWI75_RS00580 | Protein ID | WP_289266737.1 |
Coordinates | 121607..121918 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QWI75_RS00555 (DNFV4_00123) | 118101..118601 | + | 501 | WP_289266732.1 | DoxX family protein | - |
QWI75_RS00560 (DNFV4_00124) | 118657..119616 | + | 960 | WP_289266733.1 | hypothetical protein | - |
QWI75_RS00565 (DNFV4_00126) | 120086..120379 | + | 294 | WP_289266734.1 | putative addiction module antidote protein | - |
QWI75_RS00570 (DNFV4_00127) | 120527..120859 | + | 333 | WP_289266735.1 | hypothetical protein | - |
QWI75_RS00575 (DNFV4_00128) | 120910..121449 | + | 540 | WP_289266736.1 | hypothetical protein | - |
QWI75_RS00580 (DNFV4_00129) | 121607..121918 | - | 312 | WP_289266737.1 | NadS family protein | Antitoxin |
QWI75_RS00585 (DNFV4_00130) | 121915..122211 | - | 297 | WP_289266738.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QWI75_RS00590 | 122473..122577 | + | 105 | WP_289266739.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QWI75_RS00595 (DNFV4_00132) | 123474..123704 | + | 231 | WP_289266740.1 | 4-oxalocrotonate tautomerase family protein | - |
QWI75_RS00600 (DNFV4_00133) | 123856..124842 | - | 987 | WP_289266741.1 | hypothetical protein | - |
QWI75_RS00605 (DNFV4_00134) | 125367..126002 | - | 636 | WP_289266742.1 | thiopurine S-methyltransferase | - |
QWI75_RS00610 (DNFV4_00135) | 126141..126596 | - | 456 | WP_289266743.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11202.97 Da Isoelectric Point: 10.4878
>T296740 WP_289266738.1 NZ_OX365700:c122211-121915 [Nitrospira sp. DNF]
VFTAAVRRQLDDESYRALQLALLLRPTQGPIIQGGAGLRKLRWAAEGRGKRGGVRLIYYWEPASQTFYMLYLYAKNEQGD
LTADQLKVLAKLVRREFS
VFTAAVRRQLDDESYRALQLALLLRPTQGPIIQGGAGLRKLRWAAEGRGKRGGVRLIYYWEPASQTFYMLYLYAKNEQGD
LTADQLKVLAKLVRREFS
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|