Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2473197..2473381 | Replicon | chromosome |
| Accession | NZ_OX344719 | ||
| Organism | Staphylococcus aureus strain ST20190863 isolate ST20190863 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | Q2FVI9 |
| Locus tag | OOL12_RS12390 | Protein ID | WP_000482650.1 |
| Coordinates | 2473197..2473304 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2473321..2473381 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOL12_RS12365 | 2468559..2469032 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
| OOL12_RS12370 | 2469155..2470366 | - | 1212 | WP_001192076.1 | multidrug effflux MFS transporter | - |
| OOL12_RS12375 | 2470548..2471207 | - | 660 | WP_000831298.1 | membrane protein | - |
| OOL12_RS12380 | 2471267..2472409 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
| OOL12_RS12385 | 2472677..2473063 | + | 387 | WP_000779358.1 | flippase GtxA | - |
| OOL12_RS12390 | 2473197..2473304 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 2473321..2473381 | - | 61 | - | - | Antitoxin |
| OOL12_RS12395 | 2473932..2475695 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein | - |
| OOL12_RS12400 | 2475720..2477453 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
| OOL12_RS12405 | 2477684..2477851 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T296606 WP_000482650.1 NZ_OX344719:2473197-2473304 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT296606 NZ_OX344719:c2473381-2473321 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|