Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 20011..20318 | Replicon | chromosome |
| Accession | NZ_OX344719 | ||
| Organism | Staphylococcus aureus strain ST20190863 isolate ST20190863 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | OOL12_RS00110 | Protein ID | WP_011447039.1 |
| Coordinates | 20011..20187 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 20179..20318 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOL12_RS00090 (17841) | 17841..17993 | + | 153 | WP_001000058.1 | hypothetical protein | - |
| OOL12_RS00095 (18039) | 18039..18326 | + | 288 | WP_001262621.1 | hypothetical protein | - |
| OOL12_RS00100 (18382) | 18382..18756 | + | 375 | WP_000340977.1 | hypothetical protein | - |
| OOL12_RS00105 (19129) | 19129..19902 | + | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| OOL12_RS00110 (20011) | 20011..20187 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (20179) | 20179..20318 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (20179) | 20179..20318 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (20179) | 20179..20318 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (20179) | 20179..20318 | - | 140 | NuclAT_0 | - | Antitoxin |
| OOL12_RS00115 (20240) | 20240..20347 | - | 108 | WP_031762631.1 | hypothetical protein | - |
| OOL12_RS00120 (20399) | 20399..20653 | + | 255 | WP_000611508.1 | phage holin | - |
| OOL12_RS00125 (20665) | 20665..21420 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OOL12_RS00130 (21611) | 21611..22102 | + | 492 | WP_000920038.1 | staphylokinase | - |
| OOL12_RS00135 (22753) | 22753..23088 | + | 336 | Protein_26 | SH3 domain-containing protein | - |
| OOL12_RS00140 (23599) | 23599..23949 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| OOL12_RS00145 (24002) | 24002..24262 | - | 261 | WP_001791826.1 | hypothetical protein | - |
| OOL12_RS00150 (24573) | 24573..24752 | - | 180 | WP_000669791.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sea / sak / scn | 1..23949 | 23948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T296599 WP_011447039.1 NZ_OX344719:20011-20187 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT296599 NZ_OX344719:c20318-20179 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|