Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 33186..33829 Replicon plasmid P3
Accession NZ_OW970481
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name vagD Uniprot ID R9WRW3
Locus tag LQV36_RS27025 Protein ID WP_015063455.1
Coordinates 33413..33829 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQV36_RS27020 Protein ID WP_001261276.1
Coordinates 33186..33416 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV36_RS26985 (AI2764V1_5128) 28300..28569 + 270 WP_000339857.1 hypothetical protein -
LQV36_RS26990 (AI2764V1_5129) 28746..29612 - 867 WP_004118283.1 replication initiation protein -
LQV36_RS26995 30147..30251 + 105 WP_032409716.1 hypothetical protein -
LQV36_RS27000 (AI2764V1_5130) 30380..30637 + 258 WP_000764642.1 hypothetical protein -
LQV36_RS27005 (AI2764V1_5131) 30695..31471 - 777 WP_000015958.1 site-specific integrase -
LQV36_RS27010 (AI2764V1_5132) 31468..32211 - 744 WP_000129823.1 hypothetical protein -
LQV36_RS27015 (AI2764V1_5133) 32262..32612 - 351 WP_000493378.1 hypothetical protein -
LQV36_RS27020 (AI2764V1_5134) 33186..33416 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQV36_RS27025 (AI2764V1_5135) 33413..33829 + 417 WP_015063455.1 type II toxin-antitoxin system VapC family toxin Toxin
LQV36_RS27030 (AI2764V1_REPA000000081) 34073..34929 + 857 Protein_36 IS3-like element ISEc15 family transposase -
LQV36_RS27035 (AI2764V1_5138) 35211..36287 + 1077 WP_000227969.1 IS110 family transposase -
LQV36_RS27040 (AI2764V1_REPA000000078) 36304..36582 + 279 Protein_38 IS3 family transposase -
LQV36_RS27045 (AI2764V1_5140) 36885..38441 - 1557 WP_053897648.1 PAS domain-containing methyl-accepting chemotaxis protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-15 / mph(A) / dfrA12 - 1..52932 52932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15036.50 Da        Isoelectric Point: 8.5440

>T296385 WP_015063455.1 NZ_OW970481:33413-33829 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296385 WP_001261276.1 NZ_OW970481:33186-33416 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R9WRW3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References