Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 17461..18104 Replicon plasmid P3
Accession NZ_OW970447
Organism Klebsiella pneumoniae isolate 101

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag LQV08_RS27690 Protein ID WP_080884480.1
Coordinates 17688..18104 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQV08_RS27685 Protein ID WP_001261276.1
Coordinates 17461..17691 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV08_RS27650 12647..13120 + 474 WP_004152341.1 YkgJ family cysteine cluster protein -
LQV08_RS27655 13212..13442 + 231 WP_011977773.1 hypothetical protein -
LQV08_RS27660 (AI2898V1_5258) 14334..15116 - 783 WP_004152340.1 site-specific integrase -
LQV08_RS27665 (AI2898V1_5259) 15116..15448 - 333 WP_004152339.1 hypothetical protein -
LQV08_RS27670 (AI2898V1_5260) 15455..15853 - 399 WP_004171440.1 hypothetical protein -
LQV08_RS27675 (AI2898V1_5261) 15879..16208 - 330 WP_004152337.1 hypothetical protein -
LQV08_RS27680 (AI2898V1_5262) 16236..16544 - 309 WP_004152336.1 hypothetical protein -
LQV08_RS27685 (AI2898V1_5263) 17461..17691 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQV08_RS27690 (AI2898V1_5264) 17688..18104 + 417 WP_080884480.1 type II toxin-antitoxin system VapC family toxin Toxin
LQV08_RS27695 (AI2898V1_REPA000000089) 18308..19164 + 857 Protein_18 IS3-like element ISEc15 family transposase -
LQV08_RS27700 (AI2898V1_5267) 19446..20522 + 1077 WP_000227969.1 IS110 family transposase -
LQV08_RS27705 20542..20643 - 102 Protein_20 Tn3 family transposase -
LQV08_RS27710 21266..21592 - 327 WP_004201125.1 C2H2-type zinc finger protein -
LQV08_RS27715 (AI2898V1_5268) 21774..22055 + 282 WP_001568067.1 hypothetical protein -
LQV08_RS27720 (AI2898V1_5269) 22109..22720 + 612 WP_000176305.1 DUF2913 family protein -
LQV08_RS27725 (AI2898V1_REPA000000095) 22717..22848 - 132 Protein_24 ISNCY family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr - 1..38201 38201
- flank IS/Tn - - 11259..12527 1268


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15080.56 Da        Isoelectric Point: 8.5403

>T296351 WP_080884480.1 NZ_OW970447:17688-18104 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPESVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296351 WP_001261276.1 NZ_OW970447:17461-17691 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References