Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 49647..50374 | Replicon | plasmid P2 |
| Accession | NZ_OW970446 | ||
| Organism | Klebsiella pneumoniae isolate 101 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Q9LNL2 |
| Locus tag | LQV08_RS27340 | Protein ID | WP_004118600.1 |
| Coordinates | 49647..49958 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | V0AHC4 |
| Locus tag | LQV08_RS27345 | Protein ID | WP_000990392.1 |
| Coordinates | 49955..50374 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV08_RS27320 (AI2898V1_5193) | 46161..46880 | + | 720 | WP_001102107.1 | (Fe-S)-binding protein | - |
| LQV08_RS27325 (AI2898V1_5194) | 46891..48318 | + | 1428 | WP_000023895.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| LQV08_RS27330 (AI2898V1_5195) | 48311..49006 | + | 696 | WP_004118595.1 | lactate utilization protein C | - |
| LQV08_RS27335 (AI2898V1_5196) | 49056..49436 | - | 381 | Protein_46 | gluconate permease | - |
| LQV08_RS27340 (AI2898V1_5197) | 49647..49958 | + | 312 | WP_004118600.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| LQV08_RS27345 (AI2898V1_5198) | 49955..50374 | + | 420 | WP_000990392.1 | helix-turn-helix domain-containing protein | Antitoxin |
| LQV08_RS27350 (AI2898V1_5199) | 50411..51613 | - | 1203 | WP_003031541.1 | hypothetical protein | - |
| LQV08_RS27355 (AI2898V1_5200) | 51606..51935 | - | 330 | WP_004118613.1 | hypothetical protein | - |
| LQV08_RS27360 (AI2898V1_5201) | 51932..52591 | - | 660 | WP_000078540.1 | hypothetical protein | - |
| LQV08_RS27365 | 53015..53371 | - | 357 | WP_077253206.1 | Ref family recombination enhancement nuclease | - |
| LQV08_RS27370 (AI2898V1_5203) | 53491..53631 | - | 141 | WP_004118614.1 | hypothetical protein | - |
| LQV08_RS27375 (AI2898V1_5204) | 53924..54277 | + | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| LQV08_RS27380 (AI2898V1_5205) | 54325..54687 | + | 363 | WP_020324593.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / catB3 | - | 1..96925 | 96925 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12386.14 Da Isoelectric Point: 10.0935
>T296350 WP_004118600.1 NZ_OW970446:49647-49958 [Klebsiella pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15534.71 Da Isoelectric Point: 4.4702
>AT296350 WP_000990392.1 NZ_OW970446:49955-50374 [Klebsiella pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Q9LNL2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AHC4 |