Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 57973..58498 Replicon plasmid P1
Accession NZ_OW970445
Organism Klebsiella pneumoniae isolate 101

Toxin (Protein)


Gene name ccdB Uniprot ID J5VBT8
Locus tag LQV08_RS26730 Protein ID WP_004197633.1
Coordinates 58193..58498 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A9E1GDP8
Locus tag LQV08_RS26725 Protein ID WP_004197642.1
Coordinates 57973..58191 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV08_RS26695 53971..54405 - 435 WP_001567367.1 cell envelope integrity protein TolA -
LQV08_RS26700 (AI2898V1_5075) 54452..55000 - 549 WP_001567366.1 thioredoxin fold domain-containing protein -
LQV08_RS26705 55452..55802 + 351 WP_167878626.1 hypothetical protein -
LQV08_RS26710 (AI2898V1_5078) 56035..56529 - 495 WP_001568016.1 hypothetical protein -
LQV08_RS26715 (AI2898V1_5079) 56560..57132 - 573 WP_015632385.1 hypothetical protein -
LQV08_RS26720 (AI2898V1_5080) 57129..57377 - 249 WP_001568018.1 hypothetical protein -
LQV08_RS26725 (AI2898V1_5081) 57973..58191 + 219 WP_004197642.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
LQV08_RS26730 (AI2898V1_5082) 58193..58498 + 306 WP_004197633.1 type II toxin-antitoxin system toxin CcdB Toxin
LQV08_RS26735 (AI2898V1_5083) 58667..59068 + 402 WP_072199347.1 hypothetical protein -
LQV08_RS26740 (AI2898V1_5084) 59095..59418 + 324 WP_004197641.1 hypothetical protein -
LQV08_RS26745 (AI2898V1_5085) 59415..60431 + 1017 WP_004197639.1 hypothetical protein -
LQV08_RS26750 (AI2898V1_5086) 60629..61423 + 795 WP_004197635.1 site-specific integrase -
LQV08_RS26755 61871..62173 - 303 WP_004197636.1 hypothetical protein -
LQV08_RS26760 (AI2898V1_5087) 62170..62796 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaNDM-1 / ARR-3 / rmtF htpB 1..119298 119298


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11585.27 Da        Isoelectric Point: 6.4661

>T296349 WP_004197633.1 NZ_OW970445:58193-58498 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8376.34 Da        Isoelectric Point: 4.7405

>AT296349 WP_004197642.1 NZ_OW970445:57973-58191 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A5MCG5

Antitoxin

Source ID Structure

References