Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4113786..4114405 Replicon chromosome
Accession NZ_OW970444
Organism Klebsiella pneumoniae isolate 101

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LQV08_RS20260 Protein ID WP_002892050.1
Coordinates 4114187..4114405 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LQV08_RS20255 Protein ID WP_002892066.1
Coordinates 4113786..4114160 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV08_RS20245 (4108938) 4108938..4110131 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LQV08_RS20250 (4110154) 4110154..4113300 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LQV08_RS20255 (4113786) 4113786..4114160 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LQV08_RS20260 (4114187) 4114187..4114405 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LQV08_RS20265 (4114564) 4114564..4115130 + 567 WP_002892030.1 maltose O-acetyltransferase -
LQV08_RS20270 (4115102) 4115102..4115242 - 141 WP_004147370.1 hypothetical protein -
LQV08_RS20275 (4115263) 4115263..4115733 + 471 WP_002892026.1 YlaC family protein -
LQV08_RS20280 (4115708) 4115708..4117159 - 1452 WP_032419337.1 PLP-dependent aminotransferase family protein -
LQV08_RS20285 (4117260) 4117260..4117958 + 699 WP_002892021.1 GNAT family protein -
LQV08_RS20290 (4117955) 4117955..4118095 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LQV08_RS20295 (4118095) 4118095..4118358 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296345 WP_002892050.1 NZ_OW970444:4114187-4114405 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296345 WP_002892066.1 NZ_OW970444:4113786-4114160 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References