Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3936461..3937058 | Replicon | chromosome |
| Accession | NZ_OW970444 | ||
| Organism | Klebsiella pneumoniae isolate 101 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | LQV08_RS19295 | Protein ID | WP_004142563.1 |
| Coordinates | 3936741..3937058 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | LQV08_RS19290 | Protein ID | WP_004142561.1 |
| Coordinates | 3936461..3936748 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV08_RS19260 (3932542) | 3932542..3932790 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| LQV08_RS19265 (3932808) | 3932808..3933149 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| LQV08_RS19270 (3933180) | 3933180..3934295 | - | 1116 | Protein_3793 | MBL fold metallo-hydrolase | - |
| LQV08_RS19275 (3934474) | 3934474..3935055 | + | 582 | WP_032419262.1 | TetR/AcrR family transcriptional regulator | - |
| LQV08_RS19280 (3935055) | 3935055..3935423 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| LQV08_RS19285 (3935543) | 3935543..3936196 | + | 654 | WP_032419263.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| LQV08_RS19290 (3936461) | 3936461..3936748 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| LQV08_RS19295 (3936741) | 3936741..3937058 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQV08_RS19300 (3937243) | 3937243..3938286 | - | 1044 | WP_032419264.1 | DUF2157 domain-containing protein | - |
| LQV08_RS19305 (3938953) | 3938953..3939819 | - | 867 | WP_032419265.1 | helix-turn-helix transcriptional regulator | - |
| LQV08_RS19310 (3939928) | 3939928..3941355 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T296344 WP_004142563.1 NZ_OW970444:c3937058-3936741 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |