Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 116466..116991 Replicon plasmid P1
Accession NZ_OW970375
Organism Klebsiella pneumoniae isolate 101

Toxin (Protein)


Gene name ccdB Uniprot ID J5VBT8
Locus tag LQV21_RS27150 Protein ID WP_004197633.1
Coordinates 116686..116991 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A9E1GDP8
Locus tag LQV21_RS27145 Protein ID WP_004197642.1
Coordinates 116466..116684 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV21_RS27120 114256..114459 - 204 WP_004150739.1 HHA domain-containing protein -
LQV21_RS27125 (AI3007V1_5165) 114520..115014 - 495 WP_004213594.1 hypothetical protein -
LQV21_RS27130 (AI3007V1_5166) 115045..115611 - 567 WP_009310052.1 hypothetical protein -
LQV21_RS27135 (AI3007V1_5167) 115608..115871 - 264 WP_009310051.1 hypothetical protein -
LQV21_RS27140 116090..116257 + 168 Protein_123 hypothetical protein -
LQV21_RS27145 (AI3007V1_5168) 116466..116684 + 219 WP_004197642.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
LQV21_RS27150 (AI3007V1_5169) 116686..116991 + 306 WP_004197633.1 type II toxin-antitoxin system toxin CcdB Toxin
LQV21_RS27155 (AI3007V1_5170) 117160..117561 + 402 WP_072199347.1 hypothetical protein -
LQV21_RS27160 (AI3007V1_5171) 117588..117911 + 324 WP_004197641.1 hypothetical protein -
LQV21_RS27165 (AI3007V1_5172) 117908..118924 + 1017 WP_004197639.1 hypothetical protein -
LQV21_RS27170 (AI3007V1_5173) 119122..119916 + 795 WP_004197635.1 site-specific integrase -
LQV21_RS27175 120380..120682 - 303 WP_004197636.1 hypothetical protein -
LQV21_RS27180 (AI3007V1_5174) 120679..121305 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid rmtF / catB3 / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaNDM-1 / ARR-3 htpB 1..215903 215903


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11585.27 Da        Isoelectric Point: 6.4661

>T296286 WP_004197633.1 NZ_OW970375:116686-116991 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8376.34 Da        Isoelectric Point: 4.7405

>AT296286 WP_004197642.1 NZ_OW970375:116466-116684 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A5MCG5

Antitoxin

Source ID Structure

References