Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 104590..105317 Replicon plasmid P1
Accession NZ_OW970375
Organism Klebsiella pneumoniae isolate 101

Toxin (Protein)


Gene name higB Uniprot ID A0A5Q9LNL2
Locus tag LQV21_RS27080 Protein ID WP_004118600.1
Coordinates 105006..105317 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID V0AHC4
Locus tag LQV21_RS27075 Protein ID WP_000990392.1
Coordinates 104590..105009 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV21_RS27040 (AI3007V1_5146) 100277..100639 - 363 WP_020324593.1 arsenite efflux transporter metallochaperone ArsD -
LQV21_RS27045 (AI3007V1_5147) 100687..101040 - 354 WP_001114073.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
LQV21_RS27050 (AI3007V1_5148) 101333..101473 + 141 WP_004118614.1 hypothetical protein -
LQV21_RS27055 101593..101949 + 357 WP_077253206.1 Ref family recombination enhancement nuclease -
LQV21_RS27060 (AI3007V1_5150) 102373..103032 + 660 WP_000078540.1 hypothetical protein -
LQV21_RS27065 (AI3007V1_5151) 103029..103358 + 330 WP_004118613.1 hypothetical protein -
LQV21_RS27070 (AI3007V1_5152) 103351..104553 + 1203 WP_003031541.1 hypothetical protein -
LQV21_RS27075 (AI3007V1_5153) 104590..105009 - 420 WP_000990392.1 helix-turn-helix domain-containing protein Antitoxin
LQV21_RS27080 (AI3007V1_5154) 105006..105317 - 312 WP_004118600.1 type II toxin-antitoxin system HigB family toxin Toxin
LQV21_RS27085 (AI3007V1_5155) 105528..105908 + 381 Protein_112 gluconate permease -
LQV21_RS27090 (AI3007V1_5156) 105958..106653 - 696 WP_004118595.1 lactate utilization protein C -
LQV21_RS27095 (AI3007V1_5157) 106646..108073 - 1428 WP_000023895.1 LutB/LldF family L-lactate oxidation iron-sulfur protein -
LQV21_RS27100 (AI3007V1_5158) 108084..108803 - 720 WP_001102107.1 (Fe-S)-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid rmtF / catB3 / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaNDM-1 / ARR-3 htpB 1..215903 215903


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(20-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(83-136)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12386.14 Da        Isoelectric Point: 10.0935

>T296285 WP_004118600.1 NZ_OW970375:c105317-105006 [Klebsiella pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15534.71 Da        Isoelectric Point: 4.4702

>AT296285 WP_000990392.1 NZ_OW970375:c105009-104590 [Klebsiella pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LNL2

Antitoxin

Source ID Structure
AlphaFold DB V0AHC4

References