Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4137153..4137772 Replicon chromosome
Accession NZ_OW970374
Organism Klebsiella pneumoniae isolate 101

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LQV21_RS20365 Protein ID WP_002892050.1
Coordinates 4137554..4137772 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LQV21_RS20360 Protein ID WP_002892066.1
Coordinates 4137153..4137527 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV21_RS20350 (4132305) 4132305..4133498 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LQV21_RS20355 (4133521) 4133521..4136667 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LQV21_RS20360 (4137153) 4137153..4137527 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LQV21_RS20365 (4137554) 4137554..4137772 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LQV21_RS20370 (4137931) 4137931..4138497 + 567 WP_002892030.1 maltose O-acetyltransferase -
LQV21_RS20375 (4138469) 4138469..4138609 - 141 WP_004147370.1 hypothetical protein -
LQV21_RS20380 (4138630) 4138630..4139100 + 471 WP_002892026.1 YlaC family protein -
LQV21_RS20385 (4139075) 4139075..4140526 - 1452 WP_032419337.1 PLP-dependent aminotransferase family protein -
LQV21_RS20390 (4140627) 4140627..4141325 + 699 WP_002892021.1 GNAT family protein -
LQV21_RS20395 (4141322) 4141322..4141462 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LQV21_RS20400 (4141462) 4141462..4141725 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296281 WP_002892050.1 NZ_OW970374:4137554-4137772 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296281 WP_002892066.1 NZ_OW970374:4137153-4137527 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References