Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2169092..2169781 | Replicon | chromosome |
Accession | NZ_OW969633 | ||
Organism | Klebsiella aerogenes isolate 57 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | LQ131_RS10295 | Protein ID | WP_042894575.1 |
Coordinates | 2169485..2169781 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LQ131_RS10290 | Protein ID | WP_032711784.1 |
Coordinates | 2169092..2169427 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ131_RS10265 (2164292) | 2164292..2164735 | - | 444 | WP_020078629.1 | GNAT family N-acetyltransferase | - |
LQ131_RS10270 (2164916) | 2164916..2165899 | + | 984 | WP_015366313.1 | zinc transporter ZntB | - |
LQ131_RS25235 (2166187) | 2166187..2166369 | + | 183 | WP_071596126.1 | hypothetical protein | - |
LQ131_RS10275 (2166384) | 2166384..2167757 | + | 1374 | WP_230132865.1 | ATP-dependent RNA helicase DbpA | - |
LQ131_RS10280 (2167805) | 2167805..2168740 | - | 936 | WP_032711785.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
LQ131_RS10285 (2168788) | 2168788..2169057 | - | 270 | Protein_2013 | tyrosine-type recombinase/integrase | - |
LQ131_RS10290 (2169092) | 2169092..2169427 | - | 336 | WP_032711784.1 | HigA family addiction module antitoxin | Antitoxin |
LQ131_RS10295 (2169485) | 2169485..2169781 | - | 297 | WP_042894575.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ131_RS10300 (2170018) | 2170018..2170452 | - | 435 | WP_015366316.1 | universal stress protein UspF | - |
LQ131_RS10305 (2170597) | 2170597..2171739 | - | 1143 | WP_042894578.1 | porin OmpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11554.16 Da Isoelectric Point: 7.4629
>T296145 WP_042894575.1 NZ_OW969633:c2169781-2169485 [Klebsiella aerogenes]
MQNHIGSFRDVWLEEFFLHSAPHKKIPPDIHTTLARKLDIINAAVTYLDLRSPPGNRYEELNGKLEGYSSIRINQQYRLI
FKWVDGKAEDLYLDPHKY
MQNHIGSFRDVWLEEFFLHSAPHKKIPPDIHTTLARKLDIINAAVTYLDLRSPPGNRYEELNGKLEGYSSIRINQQYRLI
FKWVDGKAEDLYLDPHKY
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|