Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 56229..56483 | Replicon | plasmid P1 |
| Accession | NZ_OW968278 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | LQ166_RS25960 | Protein ID | WP_001312851.1 |
| Coordinates | 56229..56378 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 56422..56483 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ166_RS25930 (51476) | 51476..52387 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| LQ166_RS25935 (52398) | 52398..53618 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| LQ166_RS25940 (54325) | 54325..54939 | + | 615 | Protein_64 | VENN motif pre-toxin domain-containing protein | - |
| LQ166_RS25945 (54939) | 54939..55385 | - | 447 | Protein_65 | plasmid replication initiator RepA | - |
| LQ166_RS25950 (55378) | 55378..55452 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| LQ166_RS25955 (55688) | 55688..55945 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| LQ166_RS25960 (56229) | 56229..56378 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (56422) | 56422..56483 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (56422) | 56422..56483 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (56422) | 56422..56483 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (56422) | 56422..56483 | + | 62 | NuclAT_1 | - | Antitoxin |
| LQ166_RS25965 (56622) | 56622..56804 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| LQ166_RS25970 (56905) | 56905..57521 | + | 617 | Protein_70 | IS1-like element IS1A family transposase | - |
| LQ166_RS25975 (57559) | 57559..59130 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| LQ166_RS25980 (59150) | 59150..59497 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| LQ166_RS25985 (59497) | 59497..60174 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| LQ166_RS25990 (60229) | 60229..60318 | + | 90 | Protein_74 | IS1 family transposase | - |
| LQ166_RS25995 (60619) | 60619..60831 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-48 / aadA5 / qacE / sul1 / mph(A) / tet(A) | - | 1..128607 | 128607 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T296043 WP_001312851.1 NZ_OW968278:c56378-56229 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT296043 NZ_OW968278:56422-56483 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|