Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 183057..183279 | Replicon | chromosome |
Accession | NZ_OW967795 | ||
Organism | Escherichia coli isolate 538 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A3K0NFU8 |
Locus tag | LQ148_RS00860 | Protein ID | WP_000170748.1 |
Coordinates | 183172..183279 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 183057..183115 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ148_RS00840 | 178928..179911 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
LQ148_RS00845 | 179908..180912 | + | 1005 | WP_000103571.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
LQ148_RS00850 | 180942..182213 | - | 1272 | WP_001296513.1 | aromatic amino acid transport family protein | - |
LQ148_RS00855 | 182689..182796 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 183057..183115 | - | 59 | - | - | Antitoxin |
LQ148_RS00860 | 183172..183279 | + | 108 | WP_000170748.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
LQ148_RS00865 | 183655..183762 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
LQ148_RS00870 | 183848..185527 | - | 1680 | WP_022296260.1 | cellulose biosynthesis protein BcsG | - |
LQ148_RS00875 | 185524..185715 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
LQ148_RS00880 | 185712..187283 | - | 1572 | WP_001204941.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
LQ148_RS00885 | 187556..187744 | + | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3913.76 Da Isoelectric Point: 9.0157
>T295824 WP_000170748.1 NZ_OW967795:183172-183279 [Escherichia coli]
MTLAELGMAFWHDLAVPVITGILASMIVSWLNKRK
MTLAELGMAFWHDLAVPVITGILASMIVSWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 59 bp
>AT295824 NZ_OW967795:c183115-183057 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|