Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-MqsA
Location 327509..328097 Replicon chromosome
Accession NZ_OW443151
Organism Vibrio cholerae strain CNRVC190247 isolate YE-NCPHL-18035-PI

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OC536_RS15610 Protein ID WP_032477326.1
Coordinates 327509..327796 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OC536_RS15615 Protein ID WP_000071008.1
Coordinates 327783..328097 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC536_RS15560 (CNRVC190247_03124) 322545..322817 - 273 WP_000246253.1 DUF1778 domain-containing protein -
OC536_RS15565 323172..323354 + 183 WP_032477360.1 DUF645 family protein -
OC536_RS15570 (CNRVC190247_03125) 324009..324395 + 387 WP_029628680.1 MmcQ/YjbR family DNA-binding protein -
OC536_RS15575 (CNRVC190247_03126) 324537..324896 + 360 WP_001900224.1 hypothetical protein -
OC536_RS15580 (CNRVC190247_03127) 325046..325342 + 297 WP_001069046.1 hypothetical protein -
OC536_RS15585 (CNRVC190247_03128) 325948..326244 + 297 WP_000617998.1 Dabb family protein -
OC536_RS15590 326557..326679 + 123 WP_080284773.1 DUF645 family protein -
OC536_RS15595 326857..327015 + 159 Protein_283 acetyltransferase -
OC536_RS15600 327119..327272 + 154 Protein_284 DUF645 family protein -
OC536_RS15605 327389..327451 + 63 Protein_285 acetyltransferase -
OC536_RS15610 (CNRVC190247_03129) 327509..327796 + 288 WP_032477326.1 toxin HigB-2 Toxin
OC536_RS15615 (CNRVC190247_03130) 327783..328097 + 315 WP_000071008.1 DNA-binding transcriptional regulator Antitoxin
OC536_RS15620 (CNRVC190247_03131) 328266..328769 + 504 WP_032477327.1 DinB family protein -
OC536_RS15625 (CNRVC190247_03132) 328953..329183 - 231 WP_000838533.1 PAS factor family protein -
OC536_RS15630 (CNRVC190247_03133) 329411..329950 + 540 WP_000884557.1 hydrolase -
OC536_RS15635 330260..330442 + 183 WP_000923320.1 DUF645 family protein -
OC536_RS15640 (CNRVC190247_03134) 330641..330955 + 315 WP_000248689.1 DUF4144 domain-containing protein -
OC536_RS15645 331300..331446 + 147 WP_228006404.1 DUF645 family protein -
OC536_RS15650 (CNRVC190247_03135) 331664..332020 + 357 WP_001094969.1 DUF6404 family protein -
OC536_RS15655 (CNRVC190247_03136) 332164..332481 - 318 WP_001180238.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC536_RS15660 (CNRVC190247_03137) 332500..332742 - 243 WP_000557291.1 type II toxin-antitoxin system Phd/YefM family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island qnrVC4 - 308122..375907 67785
- inside Integron qnrVC4 - 308793..373362 64569


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(43-92)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11234.97 Da        Isoelectric Point: 9.7849

>T295410 WP_032477326.1 NZ_OW443151:327509-327796 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGMAFMEAWRNEQS

Download         Length: 288 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 11696.20 Da        Isoelectric Point: 6.7600

>AT295410 WP_000071008.1 NZ_OW443151:327783-328097 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References