Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 805104..805752 | Replicon | chromosome |
| Accession | NZ_OU943336 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain MDUST305 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A715BCB4 |
| Locus tag | AEG13_RS03940 | Protein ID | WP_000244762.1 |
| Coordinates | 805351..805752 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | AEG13_RS03935 | Protein ID | WP_000351186.1 |
| Coordinates | 805104..805370 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AEG13_RS03915 (SAMEA1964467_00799) | 801032..802465 | - | 1434 | WP_001230148.1 | 6-phospho-beta-glucosidase BglA | - |
| AEG13_RS03920 (SAMEA1964467_00800) | 802624..802935 | + | 312 | WP_001182971.1 | N(4)-acetylcytidine aminohydrolase | - |
| AEG13_RS03925 (SAMEA1964467_00801) | 803099..803758 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| AEG13_RS03930 (SAMEA1964467_00803) | 803874..804854 | - | 981 | WP_000874170.1 | tRNA-modifying protein YgfZ | - |
| AEG13_RS03935 (SAMEA1964467_00804) | 805104..805370 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| AEG13_RS03940 (SAMEA1964467_00805) | 805351..805752 | + | 402 | WP_000244762.1 | protein YgfX | Toxin |
| AEG13_RS03945 (SAMEA1964467_00806) | 805817..806338 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| AEG13_RS03950 (SAMEA1964467_00807) | 806451..807347 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| AEG13_RS03955 (SAMEA1964467_00808) | 807371..808084 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| AEG13_RS03960 (SAMEA1964467_00809) | 808090..809823 | + | 1734 | WP_000813396.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15773.75 Da Isoelectric Point: 10.7537
>T294906 WP_000244762.1 NZ_OU943336:805351-805752 [Salmonella enterica subsp. enterica serovar Typhi]
VVLWQSDLRVSWRAQWISLLLHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPI
VVLWQSDLRVSWRAQWISLLLHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPI
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A715BCB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |