Detailed information of TA system TA294858

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-istR/Ldr(toxin)
• Location: 1340085..1340307
• Replicon: chromosome
• Accession: NZ_OU701452
• Organism: Escherichia coli isolate CNR65D6

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: D3H2K1
• Locus tag: LWS60_RS06300
• Protein ID: WP_000170955.1
• Coordinates: 1340085..1340192 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	istR
Locus tag	-
Coordinates	1340240..1340307 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LWS60_RS06270 (1335766)	1335766..1336599	+	834	WP_000456570.1	peptide chain release factor N(5)-glutamine methyltransferase	-
LWS60_RS06275 (1336596)	1336596..1336988	+	393	WP_000200377.1	invasion regulator SirB2	-
LWS60_RS06280 (1336992)	1336992..1337801	+	810	WP_001257044.1	invasion regulator SirB1	-
LWS60_RS06285 (1337837)	1337837..1338691	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
LWS60_RS06290 (1338886)	1338886..1339344	+	459	WP_000526135.1	IS200/IS605-like element IS200C family transposase	-
LWS60_RS06295 (1339550)	1339550..1339657	-	108	WP_000176713.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (1339705)	1339705..1339771	+	67	NuclAT_29	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_29	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_29	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_29	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_33	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_33	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_33	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_33	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_37	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_37	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_37	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_37	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_41	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_41	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_41	-	-
- (1339705)	1339705..1339771	+	67	NuclAT_41	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_11	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_11	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_11	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_11	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_13	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_13	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_13	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_13	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_15	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_15	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_15	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_15	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_17	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_17	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_17	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_17	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_19	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_19	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_19	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_19	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_21	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_21	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_21	-	-
- (1339707)	1339707..1339772	+	66	NuclAT_21	-	-
LWS60_RS06300 (1340085)	1340085..1340192	-	108	WP_000170955.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (1340240)	1340240..1340307	+	68	NuclAT_10	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_10	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_10	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_10	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_12	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_12	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_12	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_12	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_14	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_14	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_14	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_14	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_16	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_16	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_16	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_16	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_18	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_18	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_18	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_18	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_20	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_20	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_20	-	Antitoxin
- (1340240)	1340240..1340307	+	68	NuclAT_20	-	Antitoxin
LWS60_RS06305 (1340597)	1340597..1341697	-	1101	WP_001309461.1	sodium-potassium/proton antiporter ChaA	-
LWS60_RS06310 (1341967)	1341967..1342197	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
LWS60_RS06315 (1342355)	1342355..1343050	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
LWS60_RS06320 (1343094)	1343094..1343447	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
LWS60_RS06325 (1343633)	1343633..1345027	+	1395	WP_001718153.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	flank	IS/Tn	-	-	1338886..1339344	458

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4013.82 Da
• Isoelectric Point: 11.4779

>T294858 WP_000170955.1 NZ_OU701452:c1340192-1340085 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 68 bp

>AT294858 NZ_OU701452:1340240-1340307 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Structures

Toxin

• AlphaFold DB: A0A829J2A9

Antitoxin