Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 3580717..3581366 Replicon chromosome
Accession NZ_OU659204
Organism Providencia alcalifaciens strain 2019-04-29291-1-1 isolate 2019-04-29291-1-1

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag LDO73_RS16240 Protein ID WP_224059415.1
Coordinates 3580717..3581136 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A6L6FAJ1
Locus tag LDO73_RS16245 Protein ID WP_036949116.1
Coordinates 3581133..3581366 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LDO73_RS16215 (NVI2019_GHJFPKLH_03251) 3575996..3576703 + 708 WP_224061211.1 phosphonate utilization transcriptional regulator PhnR -
LDO73_RS16220 (NVI2019_GHJFPKLH_03252) 3576840..3577853 + 1014 WP_224061212.1 2-aminoethylphosphonate ABC transporter substrate-binding protein -
LDO73_RS16225 (NVI2019_GHJFPKLH_03253) 3577861..3578970 + 1110 WP_224059409.1 2-aminoethylphosphonate ABC transport system ATP-binding subunit PhnT -
LDO73_RS16230 (NVI2019_GHJFPKLH_03254) 3578972..3579832 + 861 WP_224059411.1 2-aminoethylphosphonate ABC transporter permease subunit -
LDO73_RS16235 (NVI2019_GHJFPKLH_03255) 3579835..3580632 + 798 WP_224059413.1 2-aminoethylphosphonate ABC transport system, membrane component PhnV -
LDO73_RS16240 (NVI2019_GHJFPKLH_03256) 3580717..3581136 - 420 WP_224059415.1 type II toxin-antitoxin system VapC family toxin Toxin
LDO73_RS16245 (NVI2019_GHJFPKLH_03257) 3581133..3581366 - 234 WP_036949116.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LDO73_RS16250 (NVI2019_GHJFPKLH_03258) 3581695..3582630 + 936 WP_154603006.1 aspartate carbamoyltransferase -
LDO73_RS16255 (NVI2019_GHJFPKLH_03259) 3582641..3583105 + 465 WP_036949112.1 aspartate carbamoyltransferase regulatory subunit -
LDO73_RS16260 (NVI2019_GHJFPKLH_03260) 3583198..3583584 + 387 WP_036949109.1 2-iminobutanoate/2-iminopropanoate deaminase -
LDO73_RS16265 (NVI2019_GHJFPKLH_03261) 3583846..3585027 + 1182 WP_224059416.1 MFS transporter -
LDO73_RS16270 (NVI2019_GHJFPKLH_03262) 3585020..3585928 - 909 WP_224059417.1 LysR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-128)

Antitoxin

SpoVT-AbrB domain

(9-54)


Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 15542.99 Da        Isoelectric Point: 7.2915

>T294828 WP_224059415.1 NZ_OU659204:c3581136-3580717 [Providencia alcalifaciens]
VTKLYMLDTNICSFIMREQPMYLLQRLQDCVMHRHSIVISAITYSEMRFGAIGKKASLKHNFLVDAFCERLDGVLTWDKD
AIDATTAIKKALSEAGTPIGNNDTAIAGHALATNSILVTNNTREFSRVLGLKLEDWLQP

Download         Length: 420 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8932.26 Da        Isoelectric Point: 4.8660

>AT294828 WP_036949116.1 NZ_OU659204:c3581366-3581133 [Providencia alcalifaciens]
MVTKIVAVFKNGNNRAVRLPKDIDFEGVNELEISREGNRIILRPVKPNWLSLRDEDKADKDFLLEREDVIEDGRIVL

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6L6FAJ1

References