Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 581499..581837 | Replicon | chromosome |
| Accession | NZ_LT992464 | ||
| Organism | Staphylococcus aureus isolate 3_LA_115 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | DXE56_RS03175 | Protein ID | WP_114621363.1 |
| Coordinates | 581499..581675 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 581663..581837 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE56_RS03155 | 576734..580519 | + | 3786 | WP_062832899.1 | hypothetical protein | - |
| DXE56_RS03160 | 580509..580661 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE56_RS03165 | 580708..580995 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE56_RS03170 | 581053..581349 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE56_RS03175 | 581499..581675 | + | 177 | WP_114621363.1 | putative holin-like toxin | Toxin |
| - | 581663..581837 | - | 175 | - | - | Antitoxin |
| DXE56_RS03185 | 581887..582141 | + | 255 | WP_000611512.1 | phage holin | - |
| DXE56_RS03190 | 582153..582908 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE56_RS03195 | 583098..583589 | + | 492 | WP_000920041.1 | staphylokinase | - |
| DXE56_RS03210 | 584190..584524 | + | 335 | Protein_592 | SH3 domain-containing protein | - |
| DXE56_RS03215 | 584619..585068 | - | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE56_RS03220 | 585751..586101 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| DXE56_RS03225 | 586154..586414 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL / hlb / sak / chp / scn | 535602..586101 | 50499 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6881.51 Da Isoelectric Point: 10.6777
>T294136 WP_114621363.1 NZ_LT992464:581499-581675 [Staphylococcus aureus]
MDRWWLSEYKEMVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEMVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT294136 NZ_LT992464:c581837-581663 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|