293935

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 37342..37789 Replicon plasmid PP3
Accession NZ_LT963412
Organism Pseudomonas syringae isolate CFBP3840

Toxin (Protein)


Gene name relE Uniprot ID A0A3M4C5F0
Locus tag C6H39_RS30250 Protein ID WP_003348606.1
Coordinates 37342..37614 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A3M4C5H0
Locus tag C6H39_RS30255 Protein ID WP_005730485.1
Coordinates 37604..37789 (-) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H39_RS30210 32788..33069 - 282 WP_015062535.1 hypothetical protein -
C6H39_RS31675 33139..33294 + 156 WP_158662094.1 hypothetical protein -
C6H39_RS30215 33297..33524 + 228 WP_004642455.1 hypothetical protein -
C6H39_RS30220 33600..34175 - 576 WP_060402810.1 recombinase family protein -
C6H39_RS30225 34720..35541 + 822 WP_005735297.1 C58 family peptidase -
C6H39_RS30230 35580..35768 + 189 Protein_39 helix-turn-helix domain-containing protein -
C6H39_RS32210 35772..35984 + 213 Protein_40 DUF4158 domain-containing protein -
C6H39_RS30240 35982..36313 + 332 Protein_41 Tn3 family transposase -
C6H39_RS30245 36418..37131 - 714 WP_053479514.1 UPF0149 family protein -
C6H39_RS30250 37342..37614 - 273 WP_003348606.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H39_RS30255 37604..37789 - 186 WP_005730485.1 hypothetical protein Antitoxin
C6H39_RS30260 37840..38118 - 279 WP_053479513.1 hypothetical protein -
C6H39_RS30265 38211..38846 - 636 WP_054068142.1 recombinase family protein -
C6H39_RS30275 39379..39741 - 363 WP_005730278.1 hypothetical protein -
C6H39_RS30280 39732..40413 - 682 Protein_48 AAA family ATPase -
C6H39_RS30285 40725..41213 + 489 WP_024421281.1 hypothetical protein -
C6H39_RS30290 41398..41673 + 276 Protein_50 transposase -
C6H39_RS30295 42034..42306 - 273 WP_057430853.1 hypothetical protein -
C6H39_RS32215 42403..42597 - 195 Protein_52 helix-turn-helix domain-containing protein -
C6H39_RS32220 42622..42720 - 99 Protein_53 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..86369 86369
- flank IS/Tn - - 31578..32786 1208


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10199.67 Da        Isoelectric Point: 5.0749

>T293935 WP_003348606.1 NZ_LT963412:c37614-37342 [Pseudomonas syringae]
VLVEWLPQALEALEEIAGYLAERNPYAAEQMQATLEATVEALPLHPYIHRPGRVPGTREAVVHPNYLVVYRVGTERISIL
DVLHARQEYP

Download         Length: 273 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7292.18 Da        Isoelectric Point: 7.2040

>AT293935 WP_005730485.1 NZ_LT963412:c37789-37604 [Pseudomonas syringae]
MSIQLDPRVSEFETQEQADNYDRWFRQRIEHSLADPRPPVPHDEAMARVRAMIEAKRRRAS

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3M4C5F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3M4C5H0

References