Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 433501..434048 | Replicon | chromosome |
| Accession | NZ_LT963391 | ||
| Organism | Pseudomonas syringae pv. cerasicola isolate CFBP6109 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | C6H44_RS02155 | Protein ID | WP_057459291.1 |
| Coordinates | 433501..433776 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | C6H44_RS02160 | Protein ID | WP_057459292.1 |
| Coordinates | 433776..434048 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6H44_RS02140 | 430663..430944 | + | 282 | WP_060411106.1 | hypothetical protein | - |
| C6H44_RS02145 | 430925..432154 | + | 1230 | WP_104725402.1 | IS91 family transposase | - |
| C6H44_RS02150 | 432335..433336 | - | 1002 | Protein_388 | IS110-like element ISPsy16 family transposase | - |
| C6H44_RS02155 | 433501..433776 | - | 276 | WP_057459291.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| C6H44_RS02160 | 433776..434048 | - | 273 | WP_057459292.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| C6H44_RS02165 | 434070..434807 | - | 738 | WP_057459293.1 | DUF2807 domain-containing protein | - |
| C6H44_RS02170 | 434906..435016 | + | 111 | WP_081681992.1 | SPOR domain-containing protein | - |
| C6H44_RS02175 | 435143..435826 | + | 684 | Protein_393 | IS110-like element ISPsy16 family transposase | - |
| C6H44_RS02180 | 435973..436950 | - | 978 | WP_032701292.1 | IS5 family transposase | - |
| C6H44_RS02185 | 437239..437841 | - | 603 | WP_016982183.1 | adenylyl-sulfate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 430946..436950 | 6004 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10781.31 Da Isoelectric Point: 7.0128
>T293892 WP_057459291.1 NZ_LT963391:c433776-433501 [Pseudomonas syringae pv. cerasicola]
MELKWTSKALSDITRLYEFLASVNQPAAARTVQQLTAAPTTLLTNPRIGERLEEFEPRDVRRIQIGQYEMRYELVDSTIY
LLRLWHTREDR
MELKWTSKALSDITRLYEFLASVNQPAAARTVQQLTAAPTTLLTNPRIGERLEEFEPRDVRRIQIGQYEMRYELVDSTIY
LLRLWHTREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|