Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4111984..4112719 | Replicon | chromosome |
Accession | NZ_LT962688 | ||
Organism | Methylorubrum extorquens strain TK 0001 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | TK0001_RS27780 | Protein ID | WP_197707620.1 |
Coordinates | 4112282..4112719 (-) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1W6RKV4 |
Locus tag | TK0001_RS19375 | Protein ID | WP_056462529.1 |
Coordinates | 4111984..4112268 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
TK0001_RS19355 | 4107417..4109840 | - | 2424 | WP_101476128.1 | phenylalanine--tRNA ligase subunit beta | - |
TK0001_RS19360 | 4109905..4110984 | - | 1080 | WP_015950513.1 | phenylalanine--tRNA ligase subunit alpha | - |
TK0001_RS19365 | 4111169..4111534 | - | 366 | WP_003602669.1 | 50S ribosomal protein L20 | - |
TK0001_RS19370 | 4111587..4111790 | - | 204 | WP_003602670.1 | 50S ribosomal protein L35 | - |
TK0001_RS19375 | 4111984..4112268 | - | 285 | WP_056462529.1 | HigA family addiction module antidote protein | Antitoxin |
TK0001_RS27780 | 4112282..4112719 | - | 438 | WP_197707620.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
TK0001_RS19385 | 4112815..4113948 | + | 1134 | WP_015822208.1 | glycosyltransferase family 4 protein | - |
TK0001_RS19390 | 4114107..4116443 | + | 2337 | WP_056506981.1 | amylo-alpha-1,6-glucosidase | - |
TK0001_RS19395 | 4116635..4117165 | - | 531 | WP_012253214.1 | translation initiation factor IF-3 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 16455.52 Da Isoelectric Point: 7.6479
>T293866 WP_197707620.1 NZ_LT962688:c4112719-4112282 [Methylorubrum extorquens]
MVPPRAWGERQSLQPHGIPVFHICWPATQAGSRGCGCRASDGIVRCPYNDDLIILSYRNRDTEALDVHGVCHRRWRSFQA
AAGRKLDMLNAASVVSDLRSPPGNRLEKLSGDREGQWSIRINDQWRICFRWDGSGPEDVEIVDYH
MVPPRAWGERQSLQPHGIPVFHICWPATQAGSRGCGCRASDGIVRCPYNDDLIILSYRNRDTEALDVHGVCHRRWRSFQA
AAGRKLDMLNAASVVSDLRSPPGNRLEKLSGDREGQWSIRINDQWRICFRWDGSGPEDVEIVDYH
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|