Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2604213..2604808 | Replicon | chromosome |
| Accession | NZ_LT962688 | ||
| Organism | Methylorubrum extorquens strain TK 0001 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | TK0001_RS12410 | Protein ID | WP_056499989.1 |
| Coordinates | 2604518..2604808 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A1W6RNQ5 |
| Locus tag | TK0001_RS12405 | Protein ID | WP_056499991.1 |
| Coordinates | 2604213..2604515 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| TK0001_RS12385 | 2600292..2601320 | + | 1029 | WP_056118396.1 | alpha/beta hydrolase | - |
| TK0001_RS12390 | 2601429..2602040 | + | 612 | WP_101475782.1 | phosphatase PAP2 family protein | - |
| TK0001_RS12395 | 2602226..2602453 | - | 228 | WP_003603049.1 | hypothetical protein | - |
| TK0001_RS12400 | 2602623..2604191 | + | 1569 | Protein_2452 | glutamine-hydrolyzing GMP synthase | - |
| TK0001_RS12405 | 2604213..2604515 | - | 303 | WP_056499991.1 | putative addiction module antidote protein | Antitoxin |
| TK0001_RS12410 | 2604518..2604808 | - | 291 | WP_056499989.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| TK0001_RS12415 | 2605141..2605974 | + | 834 | WP_085857377.1 | ABC transporter substrate-binding protein | - |
| TK0001_RS12420 | 2605971..2607011 | + | 1041 | WP_101475783.1 | iron ABC transporter permease | - |
| TK0001_RS12425 | 2607008..2607823 | + | 816 | WP_085857376.1 | ABC transporter ATP-binding protein | - |
| TK0001_RS12430 | 2607798..2608754 | + | 957 | WP_085857375.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10689.37 Da Isoelectric Point: 10.2219
>T293865 WP_056499989.1 NZ_LT962688:c2604808-2604518 [Methylorubrum extorquens]
MPTIRRTSVFQTWIDDLRDVRAVARIAKRIDRLALGNPGDVKPVGDGVSEMRIDYGPGYRIYFTAQGKQIVILLCGGDKS
SQERDIRAAKALAKEL
MPTIRRTSVFQTWIDDLRDVRAVARIAKRIDRLALGNPGDVKPVGDGVSEMRIDYGPGYRIYFTAQGKQIVILLCGGDKS
SQERDIRAAKALAKEL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|