Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB-HicA |
Location | 1974000..1974563 | Replicon | chromosome |
Accession | NZ_LT906470 | ||
Organism | Veillonella rodentium strain NCTC12018 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | CKV62_RS09105 | Protein ID | WP_095066624.1 |
Coordinates | 1974000..1974176 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | CKV62_RS09110 | Protein ID | WP_095066625.1 |
Coordinates | 1974186..1974563 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV62_RS09075 | 1969061..1970356 | - | 1296 | WP_095066618.1 | adenylosuccinate lyase | - |
CKV62_RS09080 | 1970682..1971089 | + | 408 | WP_095066619.1 | CAAX protease | - |
CKV62_RS09085 | 1971152..1971823 | - | 672 | WP_095066620.1 | hypothetical protein | - |
CKV62_RS09090 | 1971883..1972752 | - | 870 | WP_095066621.1 | hypothetical protein | - |
CKV62_RS09095 | 1972756..1973160 | - | 405 | WP_095066622.1 | biopolymer transporter ExbD | - |
CKV62_RS09100 | 1973157..1973762 | - | 606 | WP_095066623.1 | MotA/TolQ/ExbB proton channel family protein | - |
CKV62_RS09105 | 1974000..1974176 | + | 177 | WP_095066624.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
CKV62_RS09110 | 1974186..1974563 | + | 378 | WP_095066625.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
CKV62_RS09115 | 1974759..1976012 | - | 1254 | WP_095066626.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
CKV62_RS09120 | 1976005..1978194 | - | 2190 | WP_095066627.1 | methylmalonyl-CoA mutase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6620.86 Da Isoelectric Point: 11.0818
>T293735 WP_095066624.1 NZ_LT906470:1974000-1974176 [Veillonella rodentium]
MKDKDLLKLLQKNGWKDVRQRGSYHRLKKGDKVEVITVHGRDVPAGLLNAILKRTGLI
MKDKDLLKLLQKNGWKDVRQRGSYHRLKKGDKVEVITVHGRDVPAGLLNAILKRTGLI
Download Length: 177 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13776.70 Da Isoelectric Point: 4.3023
>AT293735 WP_095066625.1 NZ_LT906470:1974186-1974563 [Veillonella rodentium]
MKFIYPAVIHDDGDGLWAEFPDLEYSSSTGATLTELLTNAQEAMELFILGALEDGGTLPEATSIRNLPCTKSTYPTLVQT
DIDLAKNSRSVKKTLTIPAWLNERALAKNLNFSQILQEALVEKTM
MKFIYPAVIHDDGDGLWAEFPDLEYSSSTGATLTELLTNAQEAMELFILGALEDGGTLPEATSIRNLPCTKSTYPTLVQT
DIDLAKNSRSVKKTLTIPAWLNERALAKNLNFSQILQEALVEKTM
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|