Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1724583..1725166 | Replicon | chromosome |
| Accession | NZ_LT903847 | ||
| Organism | Escherichia coli O127:H6 isolate EPEC1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | V0SV58 |
| Locus tag | BQ9550_RS08825 | Protein ID | WP_000254750.1 |
| Coordinates | 1724831..1725166 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | BQ9550_RS08820 | Protein ID | WP_000581937.1 |
| Coordinates | 1724583..1724831 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ9550_RS08810 | 1720922..1722223 | + | 1302 | WP_000046793.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| BQ9550_RS08815 | 1722271..1724505 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| BQ9550_RS08820 | 1724583..1724831 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| BQ9550_RS08825 | 1724831..1725166 | + | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
| BQ9550_RS08830 | 1725238..1726029 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| BQ9550_RS08835 | 1726257..1727894 | + | 1638 | WP_000210870.1 | CTP synthase (glutamine hydrolyzing) | - |
| BQ9550_RS08840 | 1727982..1729280 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T293643 WP_000254750.1 NZ_LT903847:1724831-1725166 [Escherichia coli O127:H6]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|