Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) prlF-yhaV (relBE)/YhaV-PrlF
Location 1242474..1243327 Replicon chromosome
Accession NZ_LT632614
Organism Legionella pneumophila strain ST62 isolate ST62

Toxin (Protein)


Gene name yhaV Uniprot ID -
Locus tag BT141_RS05730 Protein ID WP_042754999.1
Coordinates 1242474..1242980 (-) Length 169 a.a.

Antitoxin (Protein)


Gene name prlF Uniprot ID -
Locus tag BT141_RS05735 Protein ID WP_042754998.1
Coordinates 1242980..1243327 (-) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BT141_RS05705 1237561..1238370 - 810 WP_042755003.1 integrase domain-containing protein -
BT141_RS16345 1238772..1238960 + 189 WP_136629085.1 hypothetical protein -
BT141_RS05710 1238974..1240746 - 1773 WP_042755002.1 ATP-binding protein -
BT141_RS05715 1240940..1241203 + 264 WP_042755001.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
BT141_RS05720 1241282..1241448 + 167 Protein_1098 type II toxin-antitoxin system YafQ family toxin -
BT141_RS05725 1241739..1242098 + 360 WP_042755000.1 MarR family transcriptional regulator -
BT141_RS05730 1242474..1242980 - 507 WP_042754999.1 type II toxin-antitoxin system YhaV family toxin Toxin
BT141_RS05735 1242980..1243327 - 348 WP_042754998.1 type II toxin-antitoxin system PrlF family antitoxin Antitoxin
BT141_RS05740 1243397..1244647 - 1251 WP_042754997.1 tyrosine-type recombinase/integrase -
BT141_RS05745 1245130..1245996 + 867 WP_027220967.1 hypothetical protein -
BT141_RS05750 1246100..1246459 + 360 WP_032832446.1 hypothetical protein -
BT141_RS05755 1246504..1246878 - 375 WP_032832431.1 type II toxin-antitoxin system death-on-curing family toxin -
BT141_RS05760 1246878..1247114 - 237 WP_027220969.1 hypothetical protein -
BT141_RS05765 1247492..1247767 + 276 WP_027220970.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - lem4/smdA / lpg1106 / ravL / ravM / lem5 / ravN / lem6 / lem6 / ceg19 / lpg1124 / ravO / lpg1137 / cegC3 / lem7 / lpg1147 / lpg1148 / ravP / ravQ / lpg1158 / ravR 1140359..1363173 222814


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin endonuclease, YhaV

(14-150)

Antitoxin

PrlF antitoxin

(8-105)


Sequences

Toxin        


Download         Length: 169 a.a.        Molecular weight: 19527.21 Da        Isoelectric Point: 9.5699

>T293403 WP_042754999.1 NZ_LT632614:c1242980-1242474 [Legionella pneumophila]
MVDNSIITINGWVILCHPLFLQQVEALANEVEKAKEKDPSNFHTRNSTKKLAAIAKLAFEKIPNDPAATEFRQGSTLGNN
HKHWFRAKFFQQYRLFFRYHQESKIIIYAWVNDDSSKRAYESKADAYHIFRKMLENGHPPDNWDELLKEANNTSLMKKLT
TSLDALKS

Download         Length: 507 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13175.84 Da        Isoelectric Point: 4.9405

>AT293403 WP_042754998.1 NZ_LT632614:c1243327-1242980 [Legionella pneumophila]
MARLLQTESTLTDRYQTTVPDAVRKALHLGKRDKIRYTVQSDGHVLMTRAEKEEDPVIAEFLNFIAKDIQNNPKNLTTIN
QDLVTRINSLVANVEVNLDEPLTEDEQLTENRVSR

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References