Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2445364..2445548 | Replicon | chromosome |
| Accession | NZ_LT615218 | ||
| Organism | Staphylococcus aureus strain AUS0325 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | BQ3358_RS12510 | Protein ID | WP_000482647.1 |
| Coordinates | 2445441..2445548 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2445364..2445424 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ3358_RS12485 | 2440894..2441061 | - | 168 | WP_001792506.1 | hypothetical protein | - |
| BQ3358_RS12495 | 2441292..2443025 | - | 1734 | WP_000486491.1 | ABC transporter ATP-binding protein/permease | - |
| BQ3358_RS12500 | 2443050..2444813 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2445364..2445424 | + | 61 | - | - | Antitoxin |
| BQ3358_RS12510 | 2445441..2445548 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| BQ3358_RS12515 | 2445682..2446068 | - | 387 | WP_000779347.1 | flippase GtxA | - |
| BQ3358_RS12520 | 2446326..2447468 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| BQ3358_RS12525 | 2447528..2448187 | + | 660 | WP_000831298.1 | membrane protein | - |
| BQ3358_RS12530 | 2448369..2449580 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| BQ3358_RS12535 | 2449703..2450176 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T293317 WP_000482647.1 NZ_LT615218:c2445548-2445441 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT293317 NZ_LT615218:2445364-2445424 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|