Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1889647..1889829 Replicon chromosome
Accession NZ_LT598688
Organism Staphylococcus aureus isolate Sa_Newman_UoM

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag BN8422_RS15705 Protein ID WP_001801861.1
Coordinates 1889647..1889742 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1889770..1889829 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN8422_RS09495 1885307..1885933 + 627 WP_000669046.1 hypothetical protein -
BN8422_RS09500 1885974..1886318 + 345 WP_000627551.1 DUF3969 family protein -
BN8422_RS09505 1886416..1886967 + 552 WP_000414205.1 hypothetical protein -
BN8422_RS09510 1887185..1887826 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
BN8422_RS09515 1887940..1888125 - 186 WP_000809857.1 hypothetical protein -
BN8422_RS09520 1888127..1888303 - 177 WP_000375476.1 hypothetical protein -
BN8422_RS09525 1888314..1888697 - 384 WP_000070811.1 hypothetical protein -
BN8422_RS09535 1889301..1889444 - 144 WP_001549059.1 transposase -
BN8422_RS15705 1889647..1889742 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1889770..1889829 - 60 - - Antitoxin
BN8422_RS09540 1889865..1889966 + 102 WP_001791893.1 hypothetical protein -
BN8422_RS15360 1889944..1890120 - 177 Protein_1830 transposase -
BN8422_RS09545 1890314..1890691 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA 1882747..1922929 40182


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T293245 WP_001801861.1 NZ_LT598688:1889647-1889742 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT293245 NZ_LT598688:c1889829-1889770 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References