Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1889647..1889829 | Replicon | chromosome |
Accession | NZ_LT598688 | ||
Organism | Staphylococcus aureus isolate Sa_Newman_UoM |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | BN8422_RS15705 | Protein ID | WP_001801861.1 |
Coordinates | 1889647..1889742 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1889770..1889829 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN8422_RS09495 | 1885307..1885933 | + | 627 | WP_000669046.1 | hypothetical protein | - |
BN8422_RS09500 | 1885974..1886318 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
BN8422_RS09505 | 1886416..1886967 | + | 552 | WP_000414205.1 | hypothetical protein | - |
BN8422_RS09510 | 1887185..1887826 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
BN8422_RS09515 | 1887940..1888125 | - | 186 | WP_000809857.1 | hypothetical protein | - |
BN8422_RS09520 | 1888127..1888303 | - | 177 | WP_000375476.1 | hypothetical protein | - |
BN8422_RS09525 | 1888314..1888697 | - | 384 | WP_000070811.1 | hypothetical protein | - |
BN8422_RS09535 | 1889301..1889444 | - | 144 | WP_001549059.1 | transposase | - |
BN8422_RS15705 | 1889647..1889742 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1889770..1889829 | - | 60 | - | - | Antitoxin |
BN8422_RS09540 | 1889865..1889966 | + | 102 | WP_001791893.1 | hypothetical protein | - |
BN8422_RS15360 | 1889944..1890120 | - | 177 | Protein_1830 | transposase | - |
BN8422_RS09545 | 1890314..1890691 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1882747..1922929 | 40182 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T293245 WP_001801861.1 NZ_LT598688:1889647-1889742 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT293245 NZ_LT598688:c1889829-1889770 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|