Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1896833..1897664 Replicon chromosome
Accession NZ_LS999560
Organism Escherichia coli isolate EC-TO143

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag ECTO143_RS09080 Protein ID WP_000854815.1
Coordinates 1896833..1897207 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag ECTO143_RS09085 Protein ID WP_001280918.1
Coordinates 1897296..1897664 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO143_RS09040 1892229..1893395 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
ECTO143_RS09045 1893514..1893987 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
ECTO143_RS09050 1894185..1895243 + 1059 WP_001200889.1 FUSC family protein -
ECTO143_RS09055 1895415..1895744 + 330 WP_000450409.1 DUF496 family protein -
ECTO143_RS09060 1895845..1896027 - 183 WP_001296208.1 hypothetical protein -
ECTO143_RS09065 1896081..1896227 + 147 Protein_1734 transposase domain-containing protein -
ECTO143_RS09070 1896516..1896629 - 114 WP_001161660.1 DUF957 domain-containing protein -
ECTO143_RS09075 1896642..1896836 - 195 WP_000988600.1 hypothetical protein -
ECTO143_RS09080 1896833..1897207 - 375 WP_000854815.1 type IV toxin-antitoxin system toxin CbtA Toxin
ECTO143_RS09085 1897296..1897664 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ECTO143_RS09090 1897680..1898324 - 645 WP_000086752.1 hypothetical protein -
ECTO143_RS09095 1898343..1898564 - 222 WP_000692345.1 DUF987 domain-containing protein -
ECTO143_RS09100 1898627..1899103 - 477 WP_001186200.1 RadC family protein -
ECTO143_RS09105 1899119..1899592 - 474 WP_001542276.1 antirestriction protein -
ECTO143_RS09110 1899686..1899931 - 246 WP_001164966.1 hypothetical protein -
ECTO143_RS09115 1899931..1900749 - 819 WP_001542275.1 DUF945 domain-containing protein -
ECTO143_RS09125 1900970..1901380 - 411 WP_000846703.1 hypothetical protein -
ECTO143_RS09130 1901396..1901746 - 351 Protein_1746 hypothetical protein -
ECTO143_RS09140 1901829..1902575 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T293066 WP_000854815.1 NZ_LS999560:c1897207-1896833 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT293066 WP_001280918.1 NZ_LS999560:c1897664-1897296 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References