Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1856463..1857295 | Replicon | chromosome |
| Accession | NZ_LS998785 | ||
| Organism | Escherichia coli isolate EC-TO75 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0Q2Y5N3 |
| Locus tag | ECTO75_RS08915 | Protein ID | WP_001514886.1 |
| Coordinates | 1856463..1856837 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7U9IW59 |
| Locus tag | ECTO75_RS08920 | Protein ID | WP_001360327.1 |
| Coordinates | 1856927..1857295 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO75_RS08875 | 1851979..1852452 | + | 474 | WP_001105385.1 | DNA gyrase inhibitor SbmC | - |
| ECTO75_RS08880 | 1852651..1853709 | + | 1059 | WP_032181141.1 | FUSC family protein | - |
| ECTO75_RS08885 | 1853881..1854210 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| ECTO75_RS08890 | 1854311..1854493 | - | 183 | WP_032181276.1 | ethanolamine utilization protein | - |
| ECTO75_RS08900 | 1854947..1855975 | - | 1029 | Protein_1718 | IS110 family transposase | - |
| ECTO75_RS08905 | 1856134..1856247 | - | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| ECTO75_RS08910 | 1856260..1856466 | - | 207 | WP_000976829.1 | hypothetical protein | - |
| ECTO75_RS08915 | 1856463..1856837 | - | 375 | WP_001514886.1 | TA system toxin CbtA family protein | Toxin |
| ECTO75_RS08920 | 1856927..1857295 | - | 369 | WP_001360327.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| ECTO75_RS08925 | 1857458..1857679 | - | 222 | WP_000692286.1 | DUF987 domain-containing protein | - |
| ECTO75_RS08930 | 1857742..1858218 | - | 477 | WP_001186747.1 | RadC family protein | - |
| ECTO75_RS08935 | 1858234..1858707 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| ECTO75_RS08945 | 1859049..1859870 | - | 822 | WP_001234565.1 | DUF945 domain-containing protein | - |
| ECTO75_RS08955 | 1860026..1860184 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1856260..1891728 | 35468 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13930.91 Da Isoelectric Point: 7.2909
>T293016 WP_001514886.1 NZ_LS998785:c1856837-1856463 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.34 Da Isoelectric Point: 5.9598
>AT293016 WP_001360327.1 NZ_LS998785:c1857295-1856927 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q2Y5N3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9IW59 |