Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 561067..561626 Replicon chromosome
Accession NZ_LS997868
Organism Vibrio cholerae strain NCTC 30

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag D5R51_RS16500 Protein ID WP_119091936.1
Coordinates 561067..561345 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9L991
Locus tag D5R51_RS16505 Protein ID WP_000381183.1
Coordinates 561342..561626 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
D5R51_RS16455 556683..557597 + 915 WP_119091933.1 alpha/beta hydrolase -
D5R51_RS16460 557632..558672 - 1041 WP_119091934.1 IS481 family transposase -
D5R51_RS16470 559212..559372 + 161 Protein_521 hypothetical protein -
D5R51_RS16475 559393..559563 + 171 WP_113600562.1 DUF3709 domain-containing protein -
D5R51_RS16480 559848..560032 + 185 Protein_523 DUF3709 domain-containing protein -
D5R51_RS16485 560029..560262 + 234 WP_119091935.1 DUF3709 domain-containing protein -
D5R51_RS19005 560698..560868 + 171 Protein_525 DUF645 family protein -
D5R51_RS16500 561067..561345 - 279 WP_119091936.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
D5R51_RS16505 561342..561626 - 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
D5R51_RS16510 561876..562133 + 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
D5R51_RS16515 562121..562423 + 303 WP_000229322.1 type II toxin-antitoxin system RelE/ParE family toxin -
D5R51_RS16520 562737..562919 + 183 WP_119091920.1 DUF645 family protein -
D5R51_RS16525 563137..563493 + 357 WP_002033264.1 hypothetical protein -
D5R51_RS16530 563806..563976 + 171 Protein_532 DUF645 family protein -
D5R51_RS16535 564179..564643 + 465 WP_119091937.1 ASCH domain-containing protein -
D5R51_RS16550 565402..566268 + 867 WP_113612726.1 PSE family carbenicillin-hydrolyzing class A beta-lactamase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron blaCARB-7 - 497585..615862 118277
- flank IS/Tn - - 557632..558672 1040


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10820.53 Da        Isoelectric Point: 4.6794

>T292986 WP_119091936.1 NZ_LS997868:c561345-561067 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAEKTDELIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISIIVSYWVDGSKIRIM
RVLHQKQKFPND

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10901.25 Da        Isoelectric Point: 8.0775

>AT292986 WP_000381183.1 NZ_LS997868:c561626-561342 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A067BL33

References